BLASTX nr result
ID: Akebia24_contig00033247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033247 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] 55 1e-06 >emb|CAN64135.1| hypothetical protein VITISV_033516 [Vitis vinifera] Length = 177 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 26/54 (48%), Positives = 33/54 (61%) Frame = +1 Query: 1 LTMDHPIKRGLAIPNICFFCQSSGESLDPLLIHCSFVSEVWSHFLSLFYNLGAF 162 LT+D KRG A+PN C+ C S+ ES+D LL+HC +W F SLF L F Sbjct: 61 LTLDQIQKRGWALPNRCYLCHSNEESIDHLLLHCVKTRALWEVFFSLFGVLWVF 114 Score = 22.7 bits (47), Expect(2) = 1e-06 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 153 WCFPSSTLALFQDWQLRLTGKERGS---YGP*LLFLCAEESGWK 275 W FPSS W GK+R GP LC + WK Sbjct: 112 WVFPSSVKETLLSWNGFFVGKKRKKVWRVGP----LCIFWTVWK 151