BLASTX nr result
ID: Akebia24_contig00033209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00033209 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007139438.1| hypothetical protein PHAVU_008G029400g [Phas... 68 1e-09 ref|XP_003531870.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g... 66 4e-09 ref|XP_003599128.1| Anthocyanin 5-aromatic acyltransferase [Medi... 65 1e-08 ref|XP_002275913.1| PREDICTED: anthocyanin 5-aromatic acyltransf... 64 3e-08 ref|XP_006603948.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g... 63 5e-08 ref|XP_007149905.1| hypothetical protein PHAVU_005G108800g [Phas... 63 5e-08 ref|XP_002326110.2| anthocyanin acyltransferase family protein [... 62 8e-08 gb|EXB62319.1| Anthocyanin 5-aromatic acyltransferase [Morus not... 62 1e-07 ref|XP_003555055.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-g... 61 1e-07 gb|ACU18360.1| unknown [Glycine max] 61 1e-07 ref|XP_002313292.2| hypothetical protein POPTR_0009s06800g [Popu... 60 2e-07 ref|XP_003597100.1| Anthocyanin 5-aromatic acyltransferase [Medi... 60 2e-07 ref|XP_007219500.1| hypothetical protein PRUPE_ppa022332mg [Prun... 60 3e-07 gb|EXC13929.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-... 59 5e-07 ref|XP_007151362.1| hypothetical protein PHAVU_004G040200g [Phas... 59 7e-07 gb|AGT37412.1| anthocyanin 5-aromatic acyltransferase [Vaccinium... 59 7e-07 ref|XP_002272071.2| PREDICTED: malonyl-coenzyme A:anthocyanin 3-... 59 7e-07 ref|XP_003555054.1| PREDICTED: anthocyanin 5-aromatic acyltransf... 59 7e-07 emb|CBI18016.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, puta... 59 7e-07 >ref|XP_007139438.1| hypothetical protein PHAVU_008G029400g [Phaseolus vulgaris] gi|38194913|gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] gi|561012571|gb|ESW11432.1| hypothetical protein PHAVU_008G029400g [Phaseolus vulgaris] Length = 467 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = -2 Query: 165 KVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 KV+E+CE+SPP + +P T +P TFFD+PWLC P +R+FFY +S HF ++ Sbjct: 6 KVIEQCEVSPPPGS-VPSTSIPLTFFDLPWLCCPPLKRIFFYNFPYSTQHFFQTL 59 >ref|XP_003531870.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1-like [Glycine max] Length = 469 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/62 (41%), Positives = 41/62 (66%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMH 7 MA + KV+E+CE+ PP +P T +P TF+D+PWLC P +R+FF+ +S HF+ Sbjct: 1 MADTVTVKVIEQCEVGPPP-GTVPSTSIPLTFYDLPWLCCPPLKRIFFFNFPYSSQHFLQ 59 Query: 6 SI 1 ++ Sbjct: 60 TL 61 >ref|XP_003599128.1| Anthocyanin 5-aromatic acyltransferase [Medicago truncatula] gi|317159545|gb|ADV04047.1| malonyl CoA:flavonoid malonyltransferase 5 [Medicago truncatula] gi|355488176|gb|AES69379.1| Anthocyanin 5-aromatic acyltransferase [Medicago truncatula] Length = 468 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 165 KVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 KV+E C+I+PP + LP TFFDIPWL F +Q LFFY+ HSI+HF +I Sbjct: 9 KVIEHCKITPPINTTQTVSSLPLTFFDIPWLLFSPSQPLFFYEFPHSISHFTTTI 63 >ref|XP_002275913.1| PREDICTED: anthocyanin 5-aromatic acyltransferase [Vitis vinifera] gi|296081274|emb|CBI18018.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/61 (45%), Positives = 37/61 (60%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMH 7 MA + VLEEC +SPPS + + LP TFFDIPW+ Q +FFY+ H THF+ Sbjct: 1 MASTEMVTVLEECRVSPPSSTAVDEKSLPLTFFDIPWIHQHLVQSVFFYEYPHPKTHFIE 60 Query: 6 S 4 + Sbjct: 61 T 61 >ref|XP_006603948.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1-like [Glycine max] Length = 477 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = -2 Query: 171 KAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 K KV+E+C++SPP + +P T LP TF D+PW+ T Q +FF++ HS HF+ ++ Sbjct: 10 KLKVIEQCQVSPPPGS-VPPTSLPLTFLDLPWVYCNTVQSIFFFEFPHSCNHFLQTV 65 >ref|XP_007149905.1| hypothetical protein PHAVU_005G108800g [Phaseolus vulgaris] gi|561023169|gb|ESW21899.1| hypothetical protein PHAVU_005G108800g [Phaseolus vulgaris] Length = 473 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/54 (48%), Positives = 35/54 (64%) Frame = -2 Query: 165 KVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHS 4 K++E C++SPP +P T LP TFFDIPW + QR+FFYQ H HF+ + Sbjct: 11 KIIERCQVSPPPNC-VPSTTLPLTFFDIPWFFCNSIQRIFFYQFPHPTHHFLQT 63 >ref|XP_002326110.2| anthocyanin acyltransferase family protein [Populus trichocarpa] gi|550317525|gb|EEF00492.2| anthocyanin acyltransferase family protein [Populus trichocarpa] Length = 466 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/62 (45%), Positives = 39/62 (62%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMH 7 MA S+ KV++ ++SPP + +P T LP TFFD PW P +RLFFY+ + +FMH Sbjct: 1 MAQSHSVKVIDRVQVSPPPGS-VPTTSLPLTFFDFPWHLCPPMERLFFYELPYPTLYFMH 59 Query: 6 SI 1 I Sbjct: 60 KI 61 >gb|EXB62319.1| Anthocyanin 5-aromatic acyltransferase [Morus notabilis] Length = 472 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = -2 Query: 171 KAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 + KV+E+C++SPP+ + +P T LP T+FD+PWL + LFFY+ H I HF +I Sbjct: 7 EVKVIEQCKVSPPTGS-VPSTSLPLTYFDLPWLFVGHMKSLFFYEFPHPIHHFFETI 62 >ref|XP_003555055.1| PREDICTED: coumaroyl-CoA:anthocyanidin 3-O-glucoside-6''-O-coumaroyltransferase 1-like [Glycine max] Length = 477 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = -2 Query: 171 KAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 K KV+E+C++SPP + +P T LP F D+PW+ T Q +FF++ HS HF+ ++ Sbjct: 10 KLKVIEQCQVSPPPGS-VPPTSLPLAFLDLPWVYCDTVQSIFFFEFPHSCNHFLQTV 65 >gb|ACU18360.1| unknown [Glycine max] Length = 232 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/57 (42%), Positives = 38/57 (66%) Frame = -2 Query: 171 KAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 K KV+E+C++SPP + +P T LP F D+PW+ T Q +FF++ HS HF+ ++ Sbjct: 10 KLKVIEQCQVSPPPGS-VPPTSLPLAFLDLPWVYCDTVQSIFFFEFPHSCNHFLQTV 65 >ref|XP_002313292.2| hypothetical protein POPTR_0009s06800g [Populus trichocarpa] gi|550331198|gb|EEE87247.2| hypothetical protein POPTR_0009s06800g [Populus trichocarpa] Length = 471 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFM 10 MA S KV+E C +SPP + P T LP TF DIPWL F +Q L FY+ HS +HF+ Sbjct: 1 MAKSSTVKVVEHCIVSPPPNSA-PPTILPLTFLDIPWLFFSPSQPLTFYEYPHSTSHFL 58 >ref|XP_003597100.1| Anthocyanin 5-aromatic acyltransferase [Medicago truncatula] gi|355486148|gb|AES67351.1| Anthocyanin 5-aromatic acyltransferase [Medicago truncatula] Length = 204 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%) Frame = -2 Query: 243 LTHAHTNTHTNKLTSKHRLMAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWL-CF 67 + + +TNT+TN + KV+E +++PP +L T LP TFFDI W C Sbjct: 1 MNNTNTNTNTNITYETKFNHNNTVMMKVIEHSQVAPPPNSLPSPTTLPLTFFDISWFYCQ 60 Query: 66 PTTQRLFFYQSHHSITHFMHS 4 PT +R+FFY H HF+ + Sbjct: 61 PTVKRIFFYHFPHPTHHFLQT 81 >ref|XP_007219500.1| hypothetical protein PRUPE_ppa022332mg [Prunus persica] gi|462415962|gb|EMJ20699.1| hypothetical protein PRUPE_ppa022332mg [Prunus persica] Length = 479 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIP---QTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITH 16 MA K KVLE+C++SPP + P QT LP TF DIPWL F + LFFY+ H Sbjct: 1 MARLSKVKVLEQCQVSPPPNSCSPDISQTSLPLTFLDIPWLFFSPSLPLFFYEFPFPTCH 60 Query: 15 FMHSI 1 F ++ Sbjct: 61 FTSTV 65 >gb|EXC13929.1| Malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase [Morus notabilis] Length = 476 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/54 (44%), Positives = 36/54 (66%) Frame = -2 Query: 165 KVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHS 4 K++E+ ++SPP +P T LP +FFD+PWL F QR +FY+ HS HF+ + Sbjct: 13 KIIEQSKVSPPP-GTVPTTSLPLSFFDVPWLLFANMQRPYFYEFPHSTHHFLET 65 >ref|XP_007151362.1| hypothetical protein PHAVU_004G040200g [Phaseolus vulgaris] gi|561024671|gb|ESW23356.1| hypothetical protein PHAVU_004G040200g [Phaseolus vulgaris] Length = 456 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = -2 Query: 165 KVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 KV++ C ++P + + T LP TFFD+ WL FP QRLFFY H + F+HS+ Sbjct: 12 KVIQVCSVAPLHEPTLLPTSLPLTFFDLLWLRFPPVQRLFFYPFPHPTSSFLHSL 66 >gb|AGT37412.1| anthocyanin 5-aromatic acyltransferase [Vaccinium dunalianum] Length = 472 Score = 58.9 bits (141), Expect = 7e-07 Identities = 36/67 (53%), Positives = 40/67 (59%), Gaps = 5/67 (7%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSIT---- 19 MA S K KVLE+C+ISPP L P T LP TFFDIPWL FP +Q F S T Sbjct: 1 MAPSCKFKVLEQCKISPPPGTL-PTTSLPLTFFDIPWLLFPPSQVNPFSFSSSQTTSSTT 59 Query: 18 -HFMHSI 1 HF +SI Sbjct: 60 HHFTNSI 66 >ref|XP_002272071.2| PREDICTED: malonyl-coenzyme A:anthocyanin 3-O-glucoside-6''-O-malonyltransferase [Vitis vinifera] Length = 457 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -2 Query: 162 VLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFM 10 VLEEC +SPP A + + LP TFFD+ WL F Q LFFY+ HS THF+ Sbjct: 10 VLEECRVSPPPNA-VGEKSLPLTFFDLLWLHFHLVQSLFFYKFPHSKTHFI 59 >ref|XP_003555054.1| PREDICTED: anthocyanin 5-aromatic acyltransferase-like [Glycine max] Length = 478 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/58 (46%), Positives = 36/58 (62%) Frame = -2 Query: 174 YKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMHSI 1 + KVLE+C+I+ P + LP TFFDIPWL F +Q LFFY+ H +HF +I Sbjct: 6 FTLKVLEQCKITLPPNETTTTSFLPLTFFDIPWLFFSPSQPLFFYEFPHPTSHFTATI 63 >emb|CBI18016.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -2 Query: 162 VLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFM 10 VLEEC +SPP A + + LP TFFD+ WL F Q LFFY+ HS THF+ Sbjct: 10 VLEECRVSPPPNA-VGEKSLPLTFFDLLWLHFHLVQSLFFYKFPHSKTHFI 59 >ref|XP_002513167.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis] gi|223547665|gb|EEF49158.1| Anthocyanin 5-aromatic acyltransferase, putative [Ricinus communis] Length = 464 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/61 (50%), Positives = 36/61 (59%) Frame = -2 Query: 186 MAFSYKAKVLEECEISPPSKALIPQTPLPFTFFDIPWLCFPTTQRLFFYQSHHSITHFMH 7 MA KVLE +ISP + P T LP TFFD+PWL F Q LFFY HS +HF+ Sbjct: 1 MAKPSTIKVLEHSKISPSPNSS-PSTTLPLTFFDLPWLFFSPCQPLFFYAYPHSTSHFLS 59 Query: 6 S 4 S Sbjct: 60 S 60