BLASTX nr result
ID: Akebia24_contig00032432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00032432 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] 79 9e-13 ref|XP_002535003.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002539514.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002540127.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] Length = 478 Score = 78.6 bits (192), Expect = 9e-13 Identities = 44/74 (59%), Positives = 45/74 (60%) Frame = -2 Query: 222 EPTYTFLGLALPQHLNKGRAPKRNQPSLFKKAXXXXXXXXXXXLSGKCAVPFRPLLPC*V 43 EPTYTFLGLALPQHLNK RAPKRNQPSLFKKA + Sbjct: 310 EPTYTFLGLALPQHLNKRRAPKRNQPSLFKKA---------------------------L 342 Query: 42 TGSASESTDEPHAG 1 GSASESTDEPHAG Sbjct: 343 LGSASESTDEPHAG 356 >ref|XP_002535003.1| conserved hypothetical protein [Ricinus communis] gi|223524217|gb|EEF27385.1| conserved hypothetical protein [Ricinus communis] Length = 81 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 222 EPTYTFLGLALPQHLNKGRAPKRNQPSLFKKA 127 EPTYTFLGLALPQHL K RAPKR QPSLFKKA Sbjct: 37 EPTYTFLGLALPQHLKKRRAPKRKQPSLFKKA 68 >ref|XP_002539514.1| conserved hypothetical protein [Ricinus communis] gi|223505440|gb|EEF22868.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 222 EPTYTFLGLALPQHLNKGRAPKRNQPSLFKKA 127 EPTYTFLGLALPQHL K RAPKR QPSLFKKA Sbjct: 80 EPTYTFLGLALPQHLKKRRAPKRKQPSLFKKA 111 >ref|XP_002540127.1| conserved hypothetical protein [Ricinus communis] gi|223498957|gb|EEF22255.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 222 EPTYTFLGLALPQHLNKGRAPKRNQPSLFKKA 127 EPTYTFLGLALPQHL K RAPKR QPSLFKKA Sbjct: 64 EPTYTFLGLALPQHLKKRRAPKRKQPSLFKKA 95