BLASTX nr result
ID: Akebia24_contig00032108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00032108 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297325.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 110 3e-22 gb|EXB63844.1| UDP-galactose/UDP-glucose transporter 3 [Morus no... 109 3e-22 gb|EYU28723.1| hypothetical protein MIMGU_mgv1a009782mg [Mimulus... 108 6e-22 ref|XP_002308261.2| UDP-galactose/UDP-glucose transporter family... 108 6e-22 ref|XP_007046182.1| UDP-galactose transporter 3 isoform 2 [Theob... 108 6e-22 ref|XP_007046181.1| UDP-galactose transporter 3 isoform 1 [Theob... 108 6e-22 ref|XP_004135189.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 108 6e-22 ref|NP_001242435.1| uncharacterized protein LOC100811913 [Glycin... 108 6e-22 ref|XP_002520116.1| UDP-galactose transporter, putative [Ricinus... 108 6e-22 ref|XP_006827156.1| hypothetical protein AMTR_s00010p00252880 [A... 108 8e-22 ref|XP_003613633.1| Solute carrier family protein [Medicago trun... 108 8e-22 ref|XP_003613634.1| Solute carrier family protein [Medicago trun... 108 8e-22 ref|XP_007222577.1| hypothetical protein PRUPE_ppa008438mg [Prun... 108 1e-21 ref|XP_003519036.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 108 1e-21 ref|XP_007157674.1| hypothetical protein PHAVU_002G089000g [Phas... 107 1e-21 ref|XP_004490014.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 107 1e-21 ref|XP_002323090.1| UDP-galactose/UDP-glucose transporter family... 107 2e-21 ref|XP_006483207.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 107 2e-21 ref|XP_006438647.1| hypothetical protein CICLE_v10032069mg [Citr... 107 2e-21 ref|XP_002277178.1| PREDICTED: solute carrier family 35 member B... 107 2e-21 >ref|XP_004297325.1| PREDICTED: UDP-galactose/UDP-glucose transporter 3-like [Fragaria vesca subsp. vesca] Length = 332 Score = 110 bits (274), Expect = 3e-22 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSSKQWGCVVMVFSGLSYQIYL 317 >gb|EXB63844.1| UDP-galactose/UDP-glucose transporter 3 [Morus notabilis] Length = 342 Score = 109 bits (273), Expect = 3e-22 Identities = 54/59 (91%), Positives = 58/59 (98%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSS+LSGNPLS+KQWG V++VFSGLSYQIYL Sbjct: 269 NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSVKQWGCVVMVFSGLSYQIYL 327 >gb|EYU28723.1| hypothetical protein MIMGU_mgv1a009782mg [Mimulus guttatus] Length = 332 Score = 108 bits (271), Expect = 6e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSL NTTITTTRKFVSIVVSSLLSGNPLS +QWGSV++VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLTNTTITTTRKFVSIVVSSLLSGNPLSKQQWGSVVMVFSGLSYQIYL 317 >ref|XP_002308261.2| UDP-galactose/UDP-glucose transporter family protein [Populus trichocarpa] gi|550335956|gb|EEE91784.2| UDP-galactose/UDP-glucose transporter family protein [Populus trichocarpa] Length = 342 Score = 108 bits (271), Expect = 6e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSS+LSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 269 NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSAKQWGCVVMVFSGLSYQIYL 327 >ref|XP_007046182.1| UDP-galactose transporter 3 isoform 2 [Theobroma cacao] gi|508710117|gb|EOY02014.1| UDP-galactose transporter 3 isoform 2 [Theobroma cacao] Length = 332 Score = 108 bits (271), Expect = 6e-22 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 260 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSGKQWGCVLMVFSGLSYQIYL 318 >ref|XP_007046181.1| UDP-galactose transporter 3 isoform 1 [Theobroma cacao] gi|508710116|gb|EOY02013.1| UDP-galactose transporter 3 isoform 1 [Theobroma cacao] Length = 331 Score = 108 bits (271), Expect = 6e-22 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSGKQWGCVLMVFSGLSYQIYL 317 >ref|XP_004135189.1| PREDICTED: UDP-galactose/UDP-glucose transporter 3-like [Cucumis sativus] gi|449478437|ref|XP_004155318.1| PREDICTED: UDP-galactose/UDP-glucose transporter 3-like [Cucumis sativus] Length = 332 Score = 108 bits (271), Expect = 6e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSS+LSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVVMVFSGLSYQIYL 317 >ref|NP_001242435.1| uncharacterized protein LOC100811913 [Glycine max] gi|255635145|gb|ACU17929.1| unknown [Glycine max] Length = 330 Score = 108 bits (271), Expect = 6e-22 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 257 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSTKQWGCVFMVFSGLSYQIYL 315 >ref|XP_002520116.1| UDP-galactose transporter, putative [Ricinus communis] gi|223540608|gb|EEF42171.1| UDP-galactose transporter, putative [Ricinus communis] Length = 333 Score = 108 bits (271), Expect = 6e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSS+LSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 260 NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSTKQWGCVVLVFSGLSYQIYL 318 >ref|XP_006827156.1| hypothetical protein AMTR_s00010p00252880 [Amborella trichopoda] gi|548831585|gb|ERM94393.1| hypothetical protein AMTR_s00010p00252880 [Amborella trichopoda] Length = 331 Score = 108 bits (270), Expect = 8e-22 Identities = 54/59 (91%), Positives = 57/59 (96%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSL+SGNPLS+KQWG V +VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLVSGNPLSIKQWGCVFMVFSGLSYQIYL 317 >ref|XP_003613633.1| Solute carrier family protein [Medicago truncatula] gi|87241136|gb|ABD32994.1| UDP-galactose transporter homolog 1, related [Medicago truncatula] gi|355514968|gb|AES96591.1| Solute carrier family protein [Medicago truncatula] Length = 332 Score = 108 bits (270), Expect = 8e-22 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSTKQWGCVTMVFSGLSYQIYL 317 >ref|XP_003613634.1| Solute carrier family protein [Medicago truncatula] gi|355514969|gb|AES96592.1| Solute carrier family protein [Medicago truncatula] Length = 210 Score = 108 bits (270), Expect = 8e-22 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 137 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSTKQWGCVTMVFSGLSYQIYL 195 >ref|XP_007222577.1| hypothetical protein PRUPE_ppa008438mg [Prunus persica] gi|462419513|gb|EMJ23776.1| hypothetical protein PRUPE_ppa008438mg [Prunus persica] Length = 332 Score = 108 bits (269), Expect = 1e-21 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWGSV++VFSGLSY YL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSTKQWGSVVMVFSGLSYNTYL 317 >ref|XP_003519036.1| PREDICTED: UDP-galactose/UDP-glucose transporter 3 [Glycine max] Length = 330 Score = 108 bits (269), Expect = 1e-21 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 257 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSTKQWGCVSMVFSGLSYQIYL 315 >ref|XP_007157674.1| hypothetical protein PHAVU_002G089000g [Phaseolus vulgaris] gi|561031089|gb|ESW29668.1| hypothetical protein PHAVU_002G089000g [Phaseolus vulgaris] Length = 332 Score = 107 bits (268), Expect = 1e-21 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSS+LSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSTKQWGCVFMVFSGLSYQIYL 317 >ref|XP_004490014.1| PREDICTED: UDP-galactose/UDP-glucose transporter 3-like [Cicer arietinum] Length = 332 Score = 107 bits (268), Expect = 1e-21 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIV+SSLLSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVISSLLSGNPLSTKQWGCVSMVFSGLSYQIYL 317 >ref|XP_002323090.1| UDP-galactose/UDP-glucose transporter family protein [Populus trichocarpa] gi|222867720|gb|EEF04851.1| UDP-galactose/UDP-glucose transporter family protein [Populus trichocarpa] Length = 332 Score = 107 bits (267), Expect = 2e-21 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSLANTTITTTRKFVSIVVSS+LSGNPLS KQWG V +VFSGLSYQIYL Sbjct: 259 NFIFLTISRFGSLANTTITTTRKFVSIVVSSVLSGNPLSAKQWGCVAMVFSGLSYQIYL 317 >ref|XP_006483207.1| PREDICTED: UDP-galactose/UDP-glucose transporter 3-like [Citrus sinensis] Length = 331 Score = 107 bits (266), Expect = 2e-21 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSL NTTITTTRKFVSIVVSS+LSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 258 NFIFLTISRFGSLTNTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVLMVFSGLSYQIYL 316 >ref|XP_006438647.1| hypothetical protein CICLE_v10032069mg [Citrus clementina] gi|557540843|gb|ESR51887.1| hypothetical protein CICLE_v10032069mg [Citrus clementina] Length = 331 Score = 107 bits (266), Expect = 2e-21 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTISRFGSL NTTITTTRKFVSIVVSS+LSGNPLS KQWG V++VFSGLSYQIYL Sbjct: 258 NFIFLTISRFGSLTNTTITTTRKFVSIVVSSVLSGNPLSSKQWGCVLMVFSGLSYQIYL 316 >ref|XP_002277178.1| PREDICTED: solute carrier family 35 member B1 [Vitis vinifera] gi|296086405|emb|CBI31994.3| unnamed protein product [Vitis vinifera] Length = 332 Score = 107 bits (266), Expect = 2e-21 Identities = 54/59 (91%), Positives = 56/59 (94%) Frame = +3 Query: 3 NFIFLTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSMKQWGSVIVVFSGLSYQIYL 179 NFIFLTIS+FGSL NTTITTTRKFVSIVVSSLLSGNPLS KQWGSV +VFSGLSYQIYL Sbjct: 259 NFIFLTISQFGSLTNTTITTTRKFVSIVVSSLLSGNPLSAKQWGSVSMVFSGLSYQIYL 317