BLASTX nr result
ID: Akebia24_contig00031866
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031866 (232 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB74588.1| Poly(A) polymerase [Morus notabilis] 57 4e-06 >gb|EXB74588.1| Poly(A) polymerase [Morus notabilis] Length = 848 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = -3 Query: 230 GMEICVSHVRKKQIPSFVYPKGYK*PQPSTRLT-TSHEPGEKKSFHKDDGEECNVGCLKR 54 GMEI VSHVRK+QIPS+V+P GY+ P+PS +T + +P E K D G LK+ Sbjct: 476 GMEIYVSHVRKRQIPSYVFPDGYRRPRPSRLITPKTDKPSEDKRSQNDSGRH----YLKQ 531 Query: 53 RKDAG*QVDDLRPNKPK 3 +K G +V D + P+ Sbjct: 532 KK--GTEVLDNKVGSPE 546