BLASTX nr result
ID: Akebia24_contig00031741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031741 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509916.1| ATP binding protein, putative [Ricinus commu... 55 8e-06 >ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis] gi|223549815|gb|EEF51303.1| ATP binding protein, putative [Ricinus communis] Length = 536 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 QRPKMSDVAKMVEDIQRVDTGNRPSSETRSESLTP 105 QRPKM DV KM+E ++R+DT NRPSSE RS+S TP Sbjct: 491 QRPKMPDVVKMIESVRRIDTDNRPSSENRSQSSTP 525