BLASTX nr result
ID: Akebia24_contig00031680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031680 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resista... 84 2e-14 ref|XP_002319469.1| hypothetical protein POPTR_0013s00630g [Popu... 77 3e-12 ref|XP_002961699.1| ATP-binding cassette transporter [Selaginell... 63 5e-08 ref|XP_002964767.1| hypothetical protein SELMODRAFT_406260 [Sela... 63 5e-08 ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [A... 62 8e-08 >ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resistance protein 7-like [Vitis vinifera] Length = 1538 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 206 LAELVVCKLSTKVGHSGGIESTGRVQVGDVVTGISINNEELKYLSVGSKK 355 +AELVV KLSTKVGHSGGIE+TGRVQVGDVVT IS+NNEE++YLSVG+ K Sbjct: 495 IAELVVAKLSTKVGHSGGIETTGRVQVGDVVTAISMNNEEMQYLSVGTLK 544 >ref|XP_002319469.1| hypothetical protein POPTR_0013s00630g [Populus trichocarpa] gi|222857845|gb|EEE95392.1| hypothetical protein POPTR_0013s00630g [Populus trichocarpa] Length = 1605 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/44 (84%), Positives = 41/44 (93%) Frame = +2 Query: 212 ELVVCKLSTKVGHSGGIESTGRVQVGDVVTGISINNEELKYLSV 343 ELVV KLS KVGHSGGIESTGRVQ+GDVVTGIS+N EE++YLSV Sbjct: 582 ELVVAKLSRKVGHSGGIESTGRVQIGDVVTGISLNKEEMQYLSV 625 >ref|XP_002961699.1| ATP-binding cassette transporter [Selaginella moellendorffii] gi|300170358|gb|EFJ36959.1| ATP-binding cassette transporter [Selaginella moellendorffii] Length = 1583 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 209 AELVVCKLSTKVGHSGGIESTGRVQVGDVVTGISINNEELKYLSVGSK 352 AE+VV +LSTKV + GIESTG +Q GD+VTGIS+ N ++Y++VGSK Sbjct: 556 AEVVVSRLSTKVDQAQGIESTGHIQEGDIVTGISLRNGRMQYIAVGSK 603 >ref|XP_002964767.1| hypothetical protein SELMODRAFT_406260 [Selaginella moellendorffii] gi|300167000|gb|EFJ33605.1| hypothetical protein SELMODRAFT_406260 [Selaginella moellendorffii] Length = 1600 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = +2 Query: 209 AELVVCKLSTKVGHSGGIESTGRVQVGDVVTGISINNEELKYLSVGSK 352 AE+VV +LSTKV + GIESTG +Q GD+VTGIS+ N ++Y++VGSK Sbjct: 556 AEVVVSRLSTKVDQAQGIESTGHIQEGDIVTGISLRNGRMQYIAVGSK 603 >ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] gi|548843610|gb|ERN03264.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] Length = 1620 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +2 Query: 209 AELVVCKLSTKVGHSGGIESTGRVQVGDVVTGISINNEELKYLSVGSK 352 AELVV +LS+K+G GIEST VQVGDVV GISINNE ++YL V S+ Sbjct: 552 AELVVAELSSKIGSFEGIESTSIVQVGDVVKGISINNEGMQYLGVDSR 599