BLASTX nr result
ID: Akebia24_contig00031670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031670 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442833.1| hypothetical protein CICLE_v10018458mg [Citr... 55 1e-05 >ref|XP_006442833.1| hypothetical protein CICLE_v10018458mg [Citrus clementina] gi|557545095|gb|ESR56073.1| hypothetical protein CICLE_v10018458mg [Citrus clementina] Length = 1859 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/74 (35%), Positives = 40/74 (54%) Frame = +2 Query: 89 TVVEREQDETVQFPXXXXXXXXXXXXXXXIWKRVIPLGSFQELNILTVERCGRLRYLFTR 268 TVV+ ++ T FP IW+ ++P GSF EL IL++ C L Y+FT Sbjct: 1670 TVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTS 1729 Query: 269 TMVQRLQRLENIHI 310 +M+Q L +LE + + Sbjct: 1730 SMIQFLAKLEELTV 1743