BLASTX nr result
ID: Akebia24_contig00031621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031621 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39384.1| hypothetical protein DOTSEDRAFT_28543 [Dothistrom... 61 2e-07 >gb|EME39384.1| hypothetical protein DOTSEDRAFT_28543 [Dothistroma septosporum NZE10] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 2/46 (4%) Frame = -2 Query: 133 MFAGMQDYKRD--SEAHAARRASLKDQTAAPSGGVLANMWNSTFKG 2 +F+GMQ+YKRD S A ARR SL+DQ+A PSG +LANMWNSTFKG Sbjct: 35 LFSGMQEYKRDPNSAAGQARRESLQDQSAKPSG-MLANMWNSTFKG 79