BLASTX nr result
ID: Akebia24_contig00031246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031246 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS60091.1| Retinoblastoma-related protein 1 [Triticum urartu] 50 5e-07 >gb|EMS60091.1| Retinoblastoma-related protein 1 [Triticum urartu] Length = 747 Score = 50.1 bits (118), Expect(2) = 5e-07 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -3 Query: 181 GLLCDYRCIPNKLKIKFYKMVVRPTML*SGTEC*MFKNHHVNRLG 47 G+LCD R +P KLK KFY+M VRP ML G EC + K HV +LG Sbjct: 179 GILCDKR-VPQKLKGKFYRMTVRPAML-YGAECWLTKRRHVQQLG 221 Score = 29.3 bits (64), Expect(2) = 5e-07 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -1 Query: 213 RIKASWLKWREVYYVITD 160 RIKA W+KWR+ + ++ D Sbjct: 166 RIKAGWMKWRQAFGILCD 183