BLASTX nr result
ID: Akebia24_contig00031220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00031220 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006481430.1| PREDICTED: F-box/LRR-repeat protein At3g0303... 59 7e-07 ref|XP_006429576.1| hypothetical protein CICLE_v10011664mg [Citr... 59 7e-07 >ref|XP_006481430.1| PREDICTED: F-box/LRR-repeat protein At3g03030-like [Citrus sinensis] Length = 469 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 144 DDRISCLLDEICRHIISFLAHKDIVVTSVLSKRWRYIWAIYKN 16 +DRISCL DEI RHI+SFL K+ V T VLS +WR +WA+ N Sbjct: 17 EDRISCLPDEILRHILSFLPTKNAVATCVLSSKWRLVWALLPN 59 >ref|XP_006429576.1| hypothetical protein CICLE_v10011664mg [Citrus clementina] gi|557531633|gb|ESR42816.1| hypothetical protein CICLE_v10011664mg [Citrus clementina] Length = 464 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = -3 Query: 144 DDRISCLLDEICRHIISFLAHKDIVVTSVLSKRWRYIWAIYKN 16 +DRISCL DEI RHI+SFL K+ V T VLS +WR +WA+ N Sbjct: 17 EDRISCLPDEILRHILSFLPTKNAVATCVLSSKWRLVWALLPN 59