BLASTX nr result
ID: Akebia24_contig00029953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00029953 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC30823.1| hypothetical protein L484_028002 [Morus notabilis] 61 1e-07 >gb|EXC30823.1| hypothetical protein L484_028002 [Morus notabilis] Length = 1494 Score = 61.2 bits (147), Expect = 1e-07 Identities = 42/99 (42%), Positives = 55/99 (55%), Gaps = 6/99 (6%) Frame = -2 Query: 279 ETEVGYATFELPCQDSNPMKTDLELPVLEARSPKDIDSFIKQIHEG-EVGDATLLEPIHK 103 E G + E+ SNP +T LELPVLE RS +DID KQ+HEG +V + L + + Sbjct: 1258 EANAGNSAPEILPSSSNPSETSLELPVLEVRSFEDIDLASKQLHEGADVEEVVLPSMVEE 1317 Query: 102 -----ESIETDLKLPVLEATSLENDGSALMQSHEGEIGD 1 ES ET V+EA SLE+ AL Q EG+ G+ Sbjct: 1318 QLVVDESSETISDFKVVEARSLEDIQIALKQVSEGDNGE 1356