BLASTX nr result
ID: Akebia24_contig00028820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00028820 (220 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298655.1| PREDICTED: adenine phosphoribosyltransferase... 55 8e-06 ref|XP_006355483.1| PREDICTED: adenine phosphoribosyltransferase... 55 1e-05 ref|XP_006368184.1| MtN30 family protein [Populus trichocarpa] g... 55 1e-05 >ref|XP_004298655.1| PREDICTED: adenine phosphoribosyltransferase 1-like [Fragaria vesca subsp. vesca] Length = 182 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 95 MSACKCEDPRIQEIKTKIRVVPNFPKPGIMF 3 MSA K +DPR+ IKTKIRVVPNFPKPGIMF Sbjct: 1 MSALKDQDPRVHSIKTKIRVVPNFPKPGIMF 31 >ref|XP_006355483.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Solanum tuberosum] Length = 182 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 95 MSACKCEDPRIQEIKTKIRVVPNFPKPGIMF 3 MSACK +DPRI I+++IRVVPNFPKPGIMF Sbjct: 1 MSACKDQDPRIHAIQSRIRVVPNFPKPGIMF 31 >ref|XP_006368184.1| MtN30 family protein [Populus trichocarpa] gi|550346083|gb|ERP64753.1| MtN30 family protein [Populus trichocarpa] Length = 182 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 95 MSACKCEDPRIQEIKTKIRVVPNFPKPGIMF 3 MSA + EDPRI +IKT+IRVVPNFPKPGIMF Sbjct: 1 MSAYRDEDPRIHDIKTRIRVVPNFPKPGIMF 31