BLASTX nr result
ID: Akebia24_contig00028307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00028307 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trif... 86 5e-15 gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trif... 86 5e-15 ref|XP_001028186.1| hypothetical protein TTHERM_02641280 [Tetrah... 69 9e-10 ref|XP_003614397.1| hypothetical protein MTR_5g051160 [Medicago ... 68 1e-09 ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago ... 68 1e-09 gb|ETV89758.1| protein TAR1 [Aphanomyces invadans] 67 3e-09 ref|XP_004144976.1| PREDICTED: uncharacterized protein LOC101220... 67 3e-09 gb|EGZ04858.1| hypothetical protein PHYSODRAFT_356433 [Phytophth... 66 4e-09 gb|ACR38454.1| unknown [Zea mays] 66 6e-09 ref|XP_005855606.1| transcript antisense to ribosomal rna protei... 64 2e-08 emb|CBJ33763.1| conserved unknown protein [Ectocarpus siliculosus] 64 3e-08 ref|XP_007411821.1| hypothetical protein MELLADRAFT_88316 [Melam... 62 8e-08 ref|XP_007413992.1| hypothetical protein MELLADRAFT_90626 [Melam... 62 8e-08 ref|XP_007414500.1| hypothetical protein MELLADRAFT_91579 [Melam... 62 8e-08 ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melam... 62 8e-08 ref|XP_007417437.1| hypothetical protein MELLADRAFT_94736 [Melam... 62 8e-08 gb|EJK58439.1| hypothetical protein THAOC_21441 [Thalassiosira o... 61 2e-07 gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocerc... 60 2e-07 gb|EME38018.1| hypothetical protein DOTSEDRAFT_109051, partial [... 60 2e-07 ref|XP_003851051.1| hypothetical protein MYCGRDRAFT_30981, parti... 60 2e-07 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax] Length = 1367 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = +1 Query: 118 IHFYRFLLNDFKSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 I+FY FLLNDFKSF+ LFKVLF FPSQYLFAIGF IFS RR+L P GC KQPDS Sbjct: 907 INFYPFLLNDFKSFDSLFKVLFIFPSQYLFAIGFLLIFSLRRSLSPTQGCNTKQPDS 963 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax] Length = 1367 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = +1 Query: 118 IHFYRFLLNDFKSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 I+FY FLLNDFKSF+ LFKVLF FPSQYLFAIGF IFS RR+L P GC KQPDS Sbjct: 907 INFYPFLLNDFKSFDSLFKVLFIFPSQYLFAIGFLLIFSLRRSLSPTQGCNTKQPDS 963 >ref|XP_001028186.1| hypothetical protein TTHERM_02641280 [Tetrahymena thermophila] Length = 173 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 287 ESGCLGMQP*MGGKFLLKLNIYGKPIANKYCEGKVKRT 174 ESGCLG+QP +G K LLKLNI+G+PIANKYCEGK+KRT Sbjct: 100 ESGCLGLQPQVGDKLLLKLNIHGRPIANKYCEGKMKRT 137 >ref|XP_003614397.1| hypothetical protein MTR_5g051160 [Medicago truncatula] gi|355515732|gb|AES97355.1| hypothetical protein MTR_5g051160 [Medicago truncatula] Length = 356 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 F+ LFKVLF FPS+YLFAIG IFS RNLPP GCIPKQPDS Sbjct: 174 FDSLFKVLFIFPSRYLFAIGLSPIFSLGRNLPPDWGCIPKQPDS 217 >ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula] gi|355515718|gb|AES97341.1| hypothetical protein MTR_5g051000 [Medicago truncatula] Length = 1735 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 F+ LFKVLF FPS+YLFAIG IFS RNLPP GCIPKQPDS Sbjct: 312 FDSLFKVLFIFPSRYLFAIGLSPIFSLGRNLPPDWGCIPKQPDS 355 >gb|ETV89758.1| protein TAR1 [Aphanomyces invadans] Length = 111 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 FN LFKVLF FPS+YLFAIG IFSFR NLPP CIPKQ DS Sbjct: 20 FNSLFKVLFIFPSRYLFAIGLAPIFSFRWNLPPTLSCIPKQLDS 63 >ref|XP_004144976.1| PREDICTED: uncharacterized protein LOC101220602 isoform 1 [Cucumis sativus] gi|449454470|ref|XP_004144977.1| PREDICTED: uncharacterized protein LOC101220602 isoform 2 [Cucumis sativus] Length = 150 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 F+ LFKVLF FPS+YLFAIG IFS +NLPP GCIPKQPDS Sbjct: 35 FDSLFKVLFIFPSRYLFAIGLSPIFSLGQNLPPDWGCIPKQPDS 78 >gb|EGZ04858.1| hypothetical protein PHYSODRAFT_356433 [Phytophthora sojae] gi|348665052|gb|EGZ04888.1| hypothetical protein PHYSODRAFT_292717 [Phytophthora sojae] Length = 101 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 FN LFKVLF FPS+YLFAIG IFSFR NLPP CIPKQ DS Sbjct: 21 FNSLFKVLFIFPSRYLFAIGLAPIFSFRWNLPPTLRCIPKQRDS 64 >gb|ACR38454.1| unknown [Zea mays] Length = 212 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 F+ LFKVLF FPS+YLFAIG +FS R+LPP GCIPKQPDS Sbjct: 94 FDSLFKVLFIFPSRYLFAIGLSPVFSLGRSLPPDLGCIPKQPDS 137 >ref|XP_005855606.1| transcript antisense to ribosomal rna protein [Nannochloropsis gaditana CCMP526] gi|422293454|gb|EKU20754.1| transcript antisense to ribosomal rna protein [Nannochloropsis gaditana CCMP526] Length = 154 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/61 (59%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Frame = +1 Query: 112 T*IHFYRFL-LNDFKS-FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPD 285 T +H++ FL F++ FN LFKVL FPS+YLFAIG P IFS R NLPP C PKQ D Sbjct: 14 TTLHWFPFLPFQQFQALFNSLFKVLCIFPSRYLFAIGLPPIFSLRWNLPPALSCNPKQLD 73 Query: 286 S 288 S Sbjct: 74 S 74 >emb|CBJ33763.1| conserved unknown protein [Ectocarpus siliculosus] Length = 93 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 FN LFKVL FPS+YLFAIG P +FSFR NLPP C PKQ DS Sbjct: 50 FNSLFKVLCIFPSRYLFAIGLPPVFSFRWNLPPALSCNPKQLDS 93 >ref|XP_007411821.1| hypothetical protein MELLADRAFT_88316 [Melampsora larici-populina 98AG31] gi|328855944|gb|EGG05068.1| hypothetical protein MELLADRAFT_88316 [Melampsora larici-populina 98AG31] Length = 157 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +1 Query: 151 KSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 ++ N +FKVLF FPS+YLFAIG IFS R NLPP CIPKQ DS Sbjct: 112 RTVNSIFKVLFIFPSRYLFAIGLSLIFSLRWNLPPTLSCIPKQLDS 157 >ref|XP_007413992.1| hypothetical protein MELLADRAFT_90626 [Melampsora larici-populina 98AG31] gi|328853742|gb|EGG02879.1| hypothetical protein MELLADRAFT_90626 [Melampsora larici-populina 98AG31] Length = 320 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +1 Query: 151 KSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 ++ N +FKVLF FPS+YLFAIG IFS R NLPP CIPKQ DS Sbjct: 275 RTVNSIFKVLFIFPSRYLFAIGLSLIFSLRWNLPPTLSCIPKQLDS 320 >ref|XP_007414500.1| hypothetical protein MELLADRAFT_91579 [Melampsora larici-populina 98AG31] gi|328853102|gb|EGG02243.1| hypothetical protein MELLADRAFT_91579 [Melampsora larici-populina 98AG31] Length = 150 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +1 Query: 151 KSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 ++ N +FKVLF FPS+YLFAIG IFS R NLPP CIPKQ DS Sbjct: 105 RTVNSIFKVLFIFPSRYLFAIGLSLIFSLRWNLPPTLSCIPKQLDS 150 >ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 98AG31] gi|328848487|gb|EGF97700.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 98AG31] Length = 314 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +1 Query: 151 KSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 ++ N +FKVLF FPS+YLFAIG IFS R NLPP CIPKQ DS Sbjct: 269 RTVNSIFKVLFIFPSRYLFAIGLSLIFSLRWNLPPTLSCIPKQLDS 314 >ref|XP_007417437.1| hypothetical protein MELLADRAFT_94736 [Melampsora larici-populina 98AG31] gi|599429215|ref|XP_007418751.1| hypothetical protein MELLADRAFT_84120 [Melampsora larici-populina 98AG31] gi|599431518|ref|XP_007419460.1| hypothetical protein MELLADRAFT_86113 [Melampsora larici-populina 98AG31] gi|328848000|gb|EGF97272.1| hypothetical protein MELLADRAFT_86113 [Melampsora larici-populina 98AG31] gi|328848783|gb|EGF97981.1| hypothetical protein MELLADRAFT_84120 [Melampsora larici-populina 98AG31] gi|328850148|gb|EGF99317.1| hypothetical protein MELLADRAFT_94736 [Melampsora larici-populina 98AG31] Length = 157 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +1 Query: 151 KSFNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 ++ N +FKVLF FPS+YLFAIG IFS R NLPP CIPKQ DS Sbjct: 112 RTVNSIFKVLFIFPSRYLFAIGLSLIFSLRWNLPPTLSCIPKQLDS 157 >gb|EJK58439.1| hypothetical protein THAOC_21441 [Thalassiosira oceanica] Length = 158 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = +1 Query: 157 FNPLFKVLFTFPSQYLFAIGFP*IFSFRRNLPPI*GCIPKQPDS 288 FN LFKVL FPS+YL AIG P IFSFR NLPP C PKQ DS Sbjct: 34 FNSLFKVLCIFPSRYLCAIGIPPIFSFRWNLPPTLSCNPKQLDS 77 >gb|EME80501.1| hypothetical protein MYCFIDRAFT_54532 [Pseudocercospora fijiensis CIRAD86] Length = 181 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 194 HSTCSLSVSHRYLALEEIYLPFRAAFPNNPT 286 HSTC+LSVS RYLALEEIYLPFRAAFPNN T Sbjct: 102 HSTCALSVSGRYLALEEIYLPFRAAFPNNST 132 >gb|EME38018.1| hypothetical protein DOTSEDRAFT_109051, partial [Dothistroma septosporum NZE10] Length = 80 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 194 HSTCSLSVSHRYLALEEIYLPFRAAFPNNPT 286 HSTC+LSVS RYLALEEIYLPFRAAFPNN T Sbjct: 23 HSTCALSVSGRYLALEEIYLPFRAAFPNNST 53 >ref|XP_003851051.1| hypothetical protein MYCGRDRAFT_30981, partial [Zymoseptoria tritici IPO323] gi|398395197|ref|XP_003851057.1| hypothetical protein MYCGRDRAFT_30987, partial [Zymoseptoria tritici IPO323] gi|339470930|gb|EGP86027.1| hypothetical protein MYCGRDRAFT_30981 [Zymoseptoria tritici IPO323] gi|339470936|gb|EGP86033.1| hypothetical protein MYCGRDRAFT_30987 [Zymoseptoria tritici IPO323] Length = 80 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 194 HSTCSLSVSHRYLALEEIYLPFRAAFPNNPT 286 HSTC+LSVS RYLALEEIYLPFRAAFPNN T Sbjct: 23 HSTCALSVSGRYLALEEIYLPFRAAFPNNST 53