BLASTX nr result
ID: Akebia24_contig00027864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00027864 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64572.1| hypothetical protein VITISV_010382 [Vitis vinifera] 57 3e-06 gb|ABR17809.1| unknown [Picea sitchensis] 57 4e-06 >emb|CAN64572.1| hypothetical protein VITISV_010382 [Vitis vinifera] Length = 478 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -2 Query: 89 LVFLTVSGDHDMCVPYTGSEAWTRSLGYK 3 ++F++ SGDHDMCVPYTGS+AWTRS+GYK Sbjct: 392 ILFISGSGDHDMCVPYTGSQAWTRSVGYK 420 >gb|ABR17809.1| unknown [Picea sitchensis] Length = 494 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 95 QSLVFLTVSGDHDMCVPYTGSEAWTRSLGYK 3 +SL+F SGDHDMCVPYTGSEAWTRS+GYK Sbjct: 409 RSLIF---SGDHDMCVPYTGSEAWTRSMGYK 436