BLASTX nr result
ID: Akebia24_contig00026787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026787 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137882.1| PREDICTED: ABC transporter C family member 1... 39 3e-06 gb|ABY49842.1| hypothetical protein [Vitis hybrid cultivar] 38 8e-06 emb|CAN71748.1| hypothetical protein VITISV_019194 [Vitis vinifera] 38 8e-06 >ref|XP_004137882.1| PREDICTED: ABC transporter C family member 13-like [Cucumis sativus] Length = 2377 Score = 38.5 bits (88), Expect(2) = 3e-06 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +2 Query: 257 FVQDKTPNRTKLDNKAI*CVFLGYSSMSK 343 FV+D P+ TKLD K++ C+FLGYS + K Sbjct: 1244 FVRDVRPHHTKLDPKSLKCIFLGYSRVQK 1272 Score = 38.1 bits (87), Expect(2) = 3e-06 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 150 INRIPSRTFEGQVHLHVFQPDSILFPITPQVLRCTCLFK 266 INR+PS G++ V P LFPI P++ C C + Sbjct: 1208 INRMPSSVLNGEIPYRVLFPTKHLFPIAPKIFGCVCFVR 1246 >gb|ABY49842.1| hypothetical protein [Vitis hybrid cultivar] Length = 1382 Score = 38.1 bits (87), Expect(2) = 8e-06 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 150 INRIPSRTFEGQVHLHVFQPDSILFPITPQVLRCTC 257 INR+P+ +G + V P LFP+ P++ CTC Sbjct: 652 INRMPTVVLKGDIPYKVIHPQKSLFPLAPRIFGCTC 687 Score = 37.0 bits (84), Expect(2) = 8e-06 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 257 FVQDKTPNRTKLDNKAI*CVFLGYSSMSK 343 +V+D P TKLD KA+ CVFLGYS + K Sbjct: 688 YVRDTRPFVTKLDPKALQCVFLGYSRLQK 716 >emb|CAN71748.1| hypothetical protein VITISV_019194 [Vitis vinifera] Length = 1306 Score = 38.1 bits (87), Expect(2) = 8e-06 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 150 INRIPSRTFEGQVHLHVFQPDSILFPITPQVLRCTC 257 INR+P+ +G + V P LFP+ P++ CTC Sbjct: 643 INRMPTVVLKGDIPYKVIHPQKSLFPLAPRIFGCTC 678 Score = 37.0 bits (84), Expect(2) = 8e-06 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 257 FVQDKTPNRTKLDNKAI*CVFLGYSSMSK 343 +V+D P TKLD KA+ CVFLGYS + K Sbjct: 679 YVRDTRPFVTKLDPKALQCVFLGYSRLQK 707