BLASTX nr result
ID: Akebia24_contig00026672
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026672 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citr... 119 5e-26 ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabac... 81 6e-15 >ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] gi|557537661|gb|ESR48768.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 119 bits (297), Expect(2) = 5e-26 Identities = 69/102 (67%), Positives = 72/102 (70%), Gaps = 2/102 (1%) Frame = +3 Query: 39 MFARGNCGLSGESMTASLMHC*Y*YI*EF*IG*L*IAP--MEQRIIPDLHRGIDGDSQIS 212 M A GNCGLSGESMTASLMH + +P MEQRIIPDLHRGIDGDSQIS Sbjct: 1 MVAHGNCGLSGESMTASLMHLLVLVHLRILNWLIVNSPRTMEQRIIPDLHRGIDGDSQIS 60 Query: 213 QNRM*YDEIECNRNNAIETKTGNRLPTPNGQSEPFHSEFKNS 338 QNRM YDEIECNRN TGN LPT NGQSEPFHS+ NS Sbjct: 61 QNRMGYDEIECNRNK----DTGNGLPTFNGQSEPFHSDILNS 98 Score = 24.6 bits (52), Expect(2) = 5e-26 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +1 Query: 319 ILNLKIQNESNLPK 360 ILN I+NESNLPK Sbjct: 95 ILNSLIRNESNLPK 108 >ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabacum] gi|11466023|ref|NP_054565.1| hypothetical protein NitaCp091 [Nicotiana tabacum] gi|78102593|ref|YP_358732.1| hypothetical protein NisyCp089 [Nicotiana sylvestris] gi|78102607|ref|YP_358746.1| hypothetical protein NisyCp103 [Nicotiana sylvestris] gi|81301623|ref|YP_398918.1| hypothetical protein NitoCp088 [Nicotiana tomentosiformis] gi|81301637|ref|YP_398932.1| hypothetical protein NitoCp102 [Nicotiana tomentosiformis] gi|351653935|ref|YP_004891661.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653962|ref|YP_004891675.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11786|emb|CAA26288.1| hypothetical protein [Nicotiana tabacum] gi|11880|emb|CAA77393.1| hypothetical protein [Nicotiana tabacum] gi|473681|gb|AAA84690.1| unknown [Nicotiana tabacum] gi|1223679|emb|CAA77400.1| hypothetical protein [Nicotiana tabacum] gi|77799620|dbj|BAE46709.1| hypothetical protein [Nicotiana sylvestris] gi|77799634|dbj|BAE46723.1| hypothetical protein [Nicotiana sylvestris] gi|80750982|dbj|BAE48058.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750996|dbj|BAE48072.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453961|gb|AEO95619.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453988|gb|AEO95646.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454071|gb|AEO95728.1| hypothetical protein [synthetic construct] gi|347454097|gb|AEO95754.1| hypothetical protein [synthetic construct] gi|225251|prf||1211235CK ORF 75 Length = 75 Score = 80.9 bits (198), Expect(2) = 6e-15 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 484 LIVVMG*EWEFNSMRSNFPLFLSSSVVERSAVN*LVVGLNPTWGDLIHSEFLNSE 320 LI+VMG E E NSMRSN LFLSSSVVERSAVN LVVG NPTWGDLI SE NSE Sbjct: 21 LILVMGWERELNSMRSNLLLFLSSSVVERSAVNRLVVGSNPTWGDLIDSELKNSE 75 Score = 25.4 bits (54), Expect(2) = 6e-15 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 528 EPIRRGFGIYEGSF 487 EP+RR G YEGSF Sbjct: 6 EPLRRSSGSYEGSF 19