BLASTX nr result
ID: Akebia24_contig00026557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026557 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593625.1| Receptor-like protein kinase [Medicago trunc... 69 5e-10 gb|AFK42489.1| unknown [Medicago truncatula] 69 7e-10 ref|XP_006343224.1| PREDICTED: putative leucine-rich repeat rece... 69 9e-10 ref|XP_004234110.1| PREDICTED: receptor-like protein kinase At5g... 68 1e-09 ref|XP_006594576.1| PREDICTED: putative leucine-rich repeat rece... 68 2e-09 ref|XP_003543034.1| PREDICTED: putative leucine-rich repeat rece... 68 2e-09 ref|XP_004485811.1| PREDICTED: receptor-like protein kinase At3g... 67 3e-09 ref|XP_007148136.1| hypothetical protein PHAVU_006G183300g [Phas... 67 3e-09 ref|XP_006597454.1| PREDICTED: putative leucine-rich repeat rece... 66 4e-09 ref|XP_003547157.1| PREDICTED: putative leucine-rich repeat rece... 66 4e-09 ref|XP_007025562.1| Receptor like protein 4 isoform 1 [Theobroma... 65 8e-09 gb|EYU27999.1| hypothetical protein MIMGU_mgv1a002935mg [Mimulus... 65 1e-08 ref|XP_006347005.1| PREDICTED: probable LRR receptor-like serine... 65 1e-08 ref|XP_007159352.1| hypothetical protein PHAVU_002G230800g [Phas... 65 1e-08 ref|XP_004232910.1| PREDICTED: putative leucine-rich repeat rece... 65 1e-08 ref|XP_003542736.1| PREDICTED: putative leucine-rich repeat rece... 65 1e-08 gb|ABH07898.1| leucine-rich repeat family protein [Solanum lycop... 65 1e-08 ref|XP_006377395.1| hypothetical protein POPTR_0011s05560g [Popu... 64 2e-08 ref|XP_003528463.1| PREDICTED: putative leucine-rich repeat rece... 64 2e-08 ref|XP_004164020.1| PREDICTED: putative leucine-rich repeat rece... 64 2e-08 >ref|XP_003593625.1| Receptor-like protein kinase [Medicago truncatula] gi|355482673|gb|AES63876.1| Receptor-like protein kinase [Medicago truncatula] Length = 626 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT N+GLCGIPGLPTCGPHLS GAK+GIGLG F F Sbjct: 516 RLLHRASFNFTDNSGLCGIPGLPTCGPHLSAGAKVGIGLGAFFTF 560 >gb|AFK42489.1| unknown [Medicago truncatula] Length = 589 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT N+GLCG+PGLPTCGPHLS GAK+GIGLG F F Sbjct: 479 RLLHRASFNFTDNSGLCGVPGLPTCGPHLSAGAKVGIGLGAFFTF 523 >ref|XP_006343224.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Solanum tuberosum] Length = 624 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFV 282 ++L + +FT NAGLCGIPGLPTCGPHL+VGAKIGIGLG V Sbjct: 513 RLLHRASFNFTDNAGLCGIPGLPTCGPHLTVGAKIGIGLGACV 555 >ref|XP_004234110.1| PREDICTED: receptor-like protein kinase At5g59670-like [Solanum lycopersicum] Length = 623 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFV 282 ++L + +FT NAGLCGIPGLPTCGPHL++GAKIGIGLG V Sbjct: 512 RLLHRASFNFTDNAGLCGIPGLPTCGPHLTIGAKIGIGLGACV 554 >ref|XP_006594576.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform X3 [Glycine max] Length = 585 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGV 276 ++L + +FT NAGLCGIPGLPTCGPHLS GAK+GIGLGV Sbjct: 480 RLLHGASFNFTDNAGLCGIPGLPTCGPHLSAGAKVGIGLGV 520 >ref|XP_003543034.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform X1 [Glycine max] gi|571500048|ref|XP_006594575.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform X2 [Glycine max] Length = 625 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGV 276 ++L + +FT NAGLCGIPGLPTCGPHLS GAK+GIGLGV Sbjct: 520 RLLHGASFNFTDNAGLCGIPGLPTCGPHLSAGAKVGIGLGV 560 >ref|XP_004485811.1| PREDICTED: receptor-like protein kinase At3g21340-like [Cicer arietinum] Length = 630 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT NAGLCGIPGLPTCG HLS GAK+GIGLG F F Sbjct: 521 RLLHRASFNFTDNAGLCGIPGLPTCGRHLSAGAKVGIGLGAFFTF 565 >ref|XP_007148136.1| hypothetical protein PHAVU_006G183300g [Phaseolus vulgaris] gi|593695277|ref|XP_007148137.1| hypothetical protein PHAVU_006G183300g [Phaseolus vulgaris] gi|561021359|gb|ESW20130.1| hypothetical protein PHAVU_006G183300g [Phaseolus vulgaris] gi|561021360|gb|ESW20131.1| hypothetical protein PHAVU_006G183300g [Phaseolus vulgaris] Length = 635 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT NAGLCGIPGLPTCGPHLS GAK+GIGLG F Sbjct: 520 RLLHGASFNFTDNAGLCGIPGLPTCGPHLSAGAKVGIGLGASFTF 564 >ref|XP_006597454.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform X2 [Glycine max] Length = 599 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLG 273 ++L + +FT NAGLCGIPGLPTCGPHLS GAK+GIGLG Sbjct: 488 RLLHGASFNFTDNAGLCGIPGLPTCGPHLSAGAKVGIGLG 527 >ref|XP_003547157.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform X1 [Glycine max] Length = 631 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLG 273 ++L + +FT NAGLCGIPGLPTCGPHLS GAK+GIGLG Sbjct: 520 RLLHGASFNFTDNAGLCGIPGLPTCGPHLSAGAKVGIGLG 559 >ref|XP_007025562.1| Receptor like protein 4 isoform 1 [Theobroma cacao] gi|590624295|ref|XP_007025563.1| Receptor like protein 4 isoform 1 [Theobroma cacao] gi|508780928|gb|EOY28184.1| Receptor like protein 4 isoform 1 [Theobroma cacao] gi|508780929|gb|EOY28185.1| Receptor like protein 4 isoform 1 [Theobroma cacao] Length = 623 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT NAGLCGIPGLPTCGPHLS GAK GIG G + F Sbjct: 515 RLLNGASFNFTDNAGLCGIPGLPTCGPHLSAGAKAGIGFGASLSF 559 >gb|EYU27999.1| hypothetical protein MIMGU_mgv1a002935mg [Mimulus guttatus] Length = 624 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLG 273 ++L + +FT NAGLCGIPGLP CGPHLS GAKIGIGLG Sbjct: 516 RLLYGASFNFTDNAGLCGIPGLPACGPHLSTGAKIGIGLG 555 >ref|XP_006347005.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g29180-like [Solanum tuberosum] Length = 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFV 282 ++L +FT NAGLCGIPGLPTCG HL+VGAKIGIGLG V Sbjct: 517 RLLHRAKFNFTDNAGLCGIPGLPTCGTHLTVGAKIGIGLGACV 559 >ref|XP_007159352.1| hypothetical protein PHAVU_002G230800g [Phaseolus vulgaris] gi|561032767|gb|ESW31346.1| hypothetical protein PHAVU_002G230800g [Phaseolus vulgaris] Length = 624 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/69 (46%), Positives = 42/69 (60%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHFY*LTFANAILEGQRA 333 ++L + +FT NAGLCGIPGLPTCG HLS G KIGIGLG + LT + +R Sbjct: 515 RLLYRASFNFTDNAGLCGIPGLPTCGSHLSAGGKIGIGLGASFTIFLLTTCSVCWWKRRK 574 Query: 334 KLTASLSVS 360 + S ++ Sbjct: 575 NILRSQQIA 583 >ref|XP_004232910.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Solanum lycopersicum] Length = 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFV 282 ++L +FT NAGLCGIPGLPTCG HL+VGAKIGIGLG V Sbjct: 517 RLLHRAKFNFTDNAGLCGIPGLPTCGTHLTVGAKIGIGLGACV 559 >ref|XP_003542736.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300-like [Glycine max] Length = 626 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT NAGLCGIPGLPTCGPHLS G K+GIGLG F Sbjct: 517 RLLYRASFNFTDNAGLCGIPGLPTCGPHLSGGGKVGIGLGASFTF 561 >gb|ABH07898.1| leucine-rich repeat family protein [Solanum lycopersicum] Length = 599 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFV 282 ++L +FT NAGLCGIPGLPTCG HL+VGAKIGIGLG V Sbjct: 491 RLLHRAKFNFTDNAGLCGIPGLPTCGTHLTVGAKIGIGLGACV 533 >ref|XP_006377395.1| hypothetical protein POPTR_0011s05560g [Populus trichocarpa] gi|550327684|gb|ERP55192.1| hypothetical protein POPTR_0011s05560g [Populus trichocarpa] Length = 564 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 178 SFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 +FT NAGLCGIPGLPTCGPHLS GAKIG+ G V F Sbjct: 496 NFTDNAGLCGIPGLPTCGPHLSAGAKIGVAFGASVGF 532 >ref|XP_003528463.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like [Glycine max] Length = 624 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT NAGLCG+PGLPTCGPHLS G KIGIGLG F Sbjct: 515 RLLYRASFNFTDNAGLCGLPGLPTCGPHLSGGGKIGIGLGASFTF 559 >ref|XP_004164020.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440-like isoform 2 [Cucumis sativus] Length = 621 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +1 Query: 154 KILTMCTRSFTINAGLCGIPGLPTCGPHLSVGAKIGIGLGVFVHF 288 ++L + +FT NAGLCGIPGLP CGPHLS GAKIGI G + F Sbjct: 515 RLLHRASFNFTDNAGLCGIPGLPACGPHLSAGAKIGIAFGALIIF 559