BLASTX nr result
ID: Akebia24_contig00026410
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026410 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB00038.1| reverse transcriptase family member [Glycine max] 60 2e-07 gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 60 3e-07 gb|ABN08144.1| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DN... 57 3e-06 emb|CCH50976.1| T4.15 [Malus x robusta] 57 3e-06 gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] 56 5e-06 ref|XP_003616118.1| DNA-binding protein SMUBP-2 [Medicago trunca... 55 8e-06 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/45 (57%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 386 WLEWKCASGVLCDC-IPIKLKEKFYMTGLIKTILYKIECWTIEKQ 255 W++W+ ASGVLCD +PIKLK KFY T + TILY ECW ++ Q Sbjct: 214 WMKWRKASGVLCDAKVPIKLKGKFYRTAVRPTILYGTECWAVKSQ 258 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/45 (55%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -2 Query: 386 WLEWKCASGVLCD-CIPIKLKEKFYMTGLIKTILYKIECWTIEKQ 255 W++WK ASGVLCD C+P+KLK KFY T + +LY ECW ++ Q Sbjct: 48 WMKWKSASGVLCDRCMPLKLKGKFYRTTIRPAMLYGTECWAVKYQ 92 >gb|ABN08144.1| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-binding, putative [Medicago truncatula] Length = 195 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -2 Query: 386 WLEWKCASGVLCDC-IPIKLKEKFYMTGLIKTILYKIECWTIEKQ 255 WL+W+ ASGVLCD +P+KLK KFY T + +LY ECW ++ Q Sbjct: 106 WLKWRRASGVLCDKKVPLKLKGKFYRTAIRPALLYGTECWAVKSQ 150 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = -2 Query: 386 WLEWKCASGVLCDC-IPIKLKEKFYMTGLIKTILYKIECWTIEKQ 255 W++WK ASGVLCD +P+KLK KFY T + +LY ECW ++ Q Sbjct: 822 WMKWKSASGVLCDRRMPLKLKGKFYRTAIRPAMLYGTECWAVKHQ 866 >gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] Length = 137 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/45 (53%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = -2 Query: 386 WLEWKCASGVLCDC-IPIKLKEKFYMTGLIKTILYKIECWTIEKQ 255 WL W+ ASGVLCD +P+KLK KFY T + +LY ECW ++ Q Sbjct: 34 WLNWRRASGVLCDKKVPLKLKGKFYRTAVRPALLYGTECWAVKSQ 78 >ref|XP_003616118.1| DNA-binding protein SMUBP-2 [Medicago truncatula] gi|355517453|gb|AES99076.1| DNA-binding protein SMUBP-2 [Medicago truncatula] Length = 950 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 1/42 (2%) Frame = -2 Query: 380 EWKCASGVLCDC-IPIKLKEKFYMTGLIKTILYKIECWTIEK 258 +W+ ASGVLCD +P KLK KFY T + T+LY IECW + K Sbjct: 53 KWRSASGVLCDAKVPFKLKRKFYRTAVRPTMLYGIECWAVPK 94