BLASTX nr result
ID: Akebia24_contig00026303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026303 (200 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] 47 2e-09 ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 49 3e-07 >gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] Length = 190 Score = 46.6 bits (109), Expect(2) = 2e-09 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -3 Query: 144 RARQNASLVRDEAKPIHTIGEGSTPPF 64 R RQNASLVRDEAKP +TIGEG TP F Sbjct: 80 RRRQNASLVRDEAKPKYTIGEGKTPHF 106 Score = 40.8 bits (94), Expect(2) = 2e-09 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 71 PHFIAPGERKFDRGLER 21 PHFIAPGERKFDRGLER Sbjct: 104 PHFIAPGERKFDRGLER 120 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 48.5 bits (114), Expect(2) = 3e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 71 GVLPSPIVCIGLASSRTKEAFWRARACRNADY 166 GV PSPIVCIGLASSR+K + RARACR AD+ Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADH 104 Score = 31.6 bits (70), Expect(2) = 3e-07 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 21 PLQSSIKLAFPRRYEMG 71 PLQSSIKLAF RR EMG Sbjct: 58 PLQSSIKLAFSRRSEMG 74