BLASTX nr result
ID: Akebia24_contig00026214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026214 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78924.1| hypothetical protein (mitochondrion) [Vicia faba]... 117 2e-24 >gb|AGC78924.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803296|gb|AGC79031.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 231 Score = 117 bits (293), Expect = 2e-24 Identities = 59/82 (71%), Positives = 66/82 (80%), Gaps = 3/82 (3%) Frame = +1 Query: 121 ISSTCMRMYGAG---GDDPSSSFFEGLSDWAQNTAEPGEEINSQPSQGVGQRLPGSLEIS 291 + ST M M +G GD+PS SFFEGLS W QNTAEPGEEINSQPSQGVGQRLPG+LE + Sbjct: 70 LPSTSMMMDASGAGGGDNPSDSFFEGLSGWFQNTAEPGEEINSQPSQGVGQRLPGALERN 129 Query: 292 SPGISGESLFRDLEQPRREQSP 357 SPGISGES+FRD EQP E +P Sbjct: 130 SPGISGESIFRDFEQPGGEPAP 151