BLASTX nr result
ID: Akebia24_contig00026132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026132 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310803.1| hypothetical protein POPTR_0007s12780g [Popu... 65 1e-08 >ref|XP_002310803.1| hypothetical protein POPTR_0007s12780g [Populus trichocarpa] gi|222853706|gb|EEE91253.1| hypothetical protein POPTR_0007s12780g [Populus trichocarpa] Length = 148 Score = 65.1 bits (157), Expect = 1e-08 Identities = 37/72 (51%), Positives = 50/72 (69%), Gaps = 1/72 (1%) Frame = -2 Query: 307 KSFRLPRGSSIKLGRSNRFNSLRLVSESITLECASITSYERLSESMRVTEDEWSKGR-RK 131 +SFR+ RGSSIK GRSN S L+SESI+ EC + YE LS SMR++ D+ R RK Sbjct: 6 RSFRVERGSSIKFGRSN---SSLLISESISSECTRVARYENLSASMRMSNDQDIGYRSRK 62 Query: 130 NKGWMFLSRVFS 95 ++ + F+S+VFS Sbjct: 63 SRAYTFISKVFS 74