BLASTX nr result
ID: Akebia24_contig00026082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026082 (203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857637.1| hypothetical protein AMTR_s00061p00135540 [A... 80 3e-13 gb|EMT19668.1| hypothetical protein F775_30844 [Aegilops tauschii] 80 4e-13 gb|EMS68190.1| hypothetical protein TRIUR3_14719 [Triticum urartu] 78 1e-12 ref|XP_003573495.1| PREDICTED: probable RNA polymerase II transc... 78 1e-12 gb|ACF22789.1| transcription factor related protein [Brachypodiu... 78 1e-12 ref|XP_002276057.1| PREDICTED: probable RNA polymerase II transc... 77 2e-12 dbj|BAK04994.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 7e-12 dbj|BAK05807.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 9e-12 gb|EMS48309.1| hypothetical protein TRIUR3_27691 [Triticum urartu] 74 2e-11 ref|XP_004972830.1| PREDICTED: probable RNA polymerase II transc... 73 5e-11 ref|XP_004972829.1| PREDICTED: probable RNA polymerase II transc... 73 5e-11 ref|XP_007015597.1| BSD domain (BTF2-like transcription factors,... 72 1e-10 ref|XP_007015596.1| BSD domain (BTF2-like transcription factors,... 72 1e-10 ref|XP_007015595.1| BSD domain (BTF2-like transcription factors,... 72 1e-10 ref|XP_007015594.1| BSD domain (BTF2-like transcription factors,... 72 1e-10 ref|XP_007015593.1| BSD domain (BTF2-like transcription factors,... 72 1e-10 ref|XP_007015592.1| BSD domain (BTF2-like transcription factors,... 72 1e-10 ref|XP_002443866.1| hypothetical protein SORBIDRAFT_07g003540 [S... 71 2e-10 gb|AFW61225.1| hypothetical protein ZEAMMB73_026868 [Zea mays] 70 4e-10 gb|AFW61224.1| BSD domain containing protein [Zea mays] 70 4e-10 >ref|XP_006857637.1| hypothetical protein AMTR_s00061p00135540 [Amborella trichopoda] gi|548861733|gb|ERN19104.1| hypothetical protein AMTR_s00061p00135540 [Amborella trichopoda] Length = 626 Score = 80.1 bits (196), Expect = 3e-13 Identities = 41/67 (61%), Positives = 51/67 (76%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 DVCRD VG+VLG+LQ + + + A+VV + + HD QLS AEME+RM LLREDSELQK Sbjct: 89 DVCRDLVGRVLGRLQCLPPSDQSAQVVPAQPTT-QHDNQLSMAEMEQRMNLLREDSELQK 147 Query: 181 LHKQFVI 201 LH+Q VI Sbjct: 148 LHRQLVI 154 >gb|EMT19668.1| hypothetical protein F775_30844 [Aegilops tauschii] Length = 611 Score = 79.7 bits (195), Expect = 4e-13 Identities = 44/67 (65%), Positives = 50/67 (74%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + V SEKSA EQLS+AEMERRMKLLREDSELQK Sbjct: 91 DLCRDFVARVLGKHQG--TVPARTNVPSEKSAVSTGPEQLSSAEMERRMKLLREDSELQK 148 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 149 LHKKFVL 155 >gb|EMS68190.1| hypothetical protein TRIUR3_14719 [Triticum urartu] Length = 667 Score = 77.8 bits (190), Expect = 1e-12 Identities = 43/67 (64%), Positives = 49/67 (73%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + V EKSA EQLS+AEMERRMKLLREDSELQK Sbjct: 91 DLCRDFVARVLGKHQG--TVPARTNVPPEKSAVSTGPEQLSSAEMERRMKLLREDSELQK 148 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 149 LHKKFVL 155 >ref|XP_003573495.1| PREDICTED: probable RNA polymerase II transcription factor B subunit 1-1-like [Brachypodium distachyon] Length = 602 Score = 77.8 bits (190), Expect = 1e-12 Identities = 42/67 (62%), Positives = 50/67 (74%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + +A EKS + EQLS+AEMERRMKLLREDSELQK Sbjct: 91 DLCRDFVARVLGKHQGIVPPRPNAP--PEKSVAAAGPEQLSSAEMERRMKLLREDSELQK 148 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 149 LHKKFVL 155 >gb|ACF22789.1| transcription factor related protein [Brachypodium distachyon] Length = 576 Score = 77.8 bits (190), Expect = 1e-12 Identities = 42/67 (62%), Positives = 50/67 (74%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + +A EKS + EQLS+AEMERRMKLLREDSELQK Sbjct: 91 DLCRDFVARVLGKHQGIVPPRPNAP--PEKSVAAAGPEQLSSAEMERRMKLLREDSELQK 148 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 149 LHKKFVL 155 >ref|XP_002276057.1| PREDICTED: probable RNA polymerase II transcription factor B subunit 1-1 [Vitis vinifera] gi|296090002|emb|CBI39821.3| unnamed protein product [Vitis vinifera] Length = 602 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/67 (61%), Positives = 48/67 (71%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 +VCR+FVG+ L K G SE+SA + DEQLST EMERR+KLLREDSELQK Sbjct: 90 EVCREFVGRALAKFSEASKAG------SEQSAVKLFDEQLSTIEMERRIKLLREDSELQK 143 Query: 181 LHKQFVI 201 LHKQFV+ Sbjct: 144 LHKQFVL 150 >dbj|BAK04994.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 596 Score = 75.5 bits (184), Expect = 7e-12 Identities = 42/67 (62%), Positives = 48/67 (71%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + V E SA EQLS+AEMERRMKLLREDSELQK Sbjct: 87 DLCRDFVARVLGKYQG--TVPARPNVPPELSAVSTGPEQLSSAEMERRMKLLREDSELQK 144 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 145 LHKKFVL 151 >dbj|BAK05807.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 600 Score = 75.1 bits (183), Expect = 9e-12 Identities = 42/67 (62%), Positives = 48/67 (71%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + V EK A EQLS+AEMERRMKLLREDSELQK Sbjct: 91 DLCRDFVARVLGKHQG--TVPARPNVPPEKLAVSTGPEQLSSAEMERRMKLLREDSELQK 148 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 149 LHKKFVL 155 >gb|EMS48309.1| hypothetical protein TRIUR3_27691 [Triticum urartu] Length = 592 Score = 74.3 bits (181), Expect = 2e-11 Identities = 42/67 (62%), Positives = 48/67 (71%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + V E SA EQLS+AEMERRMKLLREDSELQK Sbjct: 91 DLCRDFVARVLGKHQG--TVPARPNVPPEISAVSTGPEQLSSAEMERRMKLLREDSELQK 148 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 149 LHKKFVL 155 >ref|XP_004972830.1| PREDICTED: probable RNA polymerase II transcription factor B subunit 1-1-like isoform X2 [Setaria italica] Length = 476 Score = 72.8 bits (177), Expect = 5e-11 Identities = 40/67 (59%), Positives = 48/67 (71%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q M +S SA + EQLS AE+ERR+KLLREDSELQK Sbjct: 89 DLCRDFVARVLGKHQGMPPRPTMPPEISVPSAGM---EQLSAAEVERRVKLLREDSELQK 145 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 146 LHKKFVL 152 >ref|XP_004972829.1| PREDICTED: probable RNA polymerase II transcription factor B subunit 1-1-like isoform X1 [Setaria italica] Length = 600 Score = 72.8 bits (177), Expect = 5e-11 Identities = 40/67 (59%), Positives = 48/67 (71%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q M +S SA + EQLS AE+ERR+KLLREDSELQK Sbjct: 89 DLCRDFVARVLGKHQGMPPRPTMPPEISVPSAGM---EQLSAAEVERRVKLLREDSELQK 145 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 146 LHKKFVL 152 >ref|XP_007015597.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 6 [Theobroma cacao] gi|508785960|gb|EOY33216.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 6 [Theobroma cacao] Length = 467 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 7 CRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQKLH 186 CRDFVGKVL K + VSEK DEQLS AEME R+KLLREDSELQKLH Sbjct: 91 CRDFVGKVLAK----------SGEVSEKPTVTYPDEQLSAAEMELRIKLLREDSELQKLH 140 Query: 187 KQFVI 201 KQFV+ Sbjct: 141 KQFVL 145 >ref|XP_007015596.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins), putative isoform 5, partial [Theobroma cacao] gi|508785959|gb|EOY33215.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins), putative isoform 5, partial [Theobroma cacao] Length = 481 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 7 CRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQKLH 186 CRDFVGKVL K + VSEK DEQLS AEME R+KLLREDSELQKLH Sbjct: 91 CRDFVGKVLAK----------SGEVSEKPTVTYPDEQLSAAEMELRIKLLREDSELQKLH 140 Query: 187 KQFVI 201 KQFV+ Sbjct: 141 KQFVL 145 >ref|XP_007015595.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 4, partial [Theobroma cacao] gi|508785958|gb|EOY33214.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 4, partial [Theobroma cacao] Length = 516 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 7 CRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQKLH 186 CRDFVGKVL K + VSEK DEQLS AEME R+KLLREDSELQKLH Sbjct: 47 CRDFVGKVLAK----------SGEVSEKPTVTYPDEQLSAAEMELRIKLLREDSELQKLH 96 Query: 187 KQFVI 201 KQFV+ Sbjct: 97 KQFVL 101 >ref|XP_007015594.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 3 [Theobroma cacao] gi|508785957|gb|EOY33213.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 3 [Theobroma cacao] Length = 549 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 7 CRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQKLH 186 CRDFVGKVL K + VSEK DEQLS AEME R+KLLREDSELQKLH Sbjct: 91 CRDFVGKVLAK----------SGEVSEKPTVTYPDEQLSAAEMELRIKLLREDSELQKLH 140 Query: 187 KQFVI 201 KQFV+ Sbjct: 141 KQFVL 145 >ref|XP_007015593.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 2, partial [Theobroma cacao] gi|508785956|gb|EOY33212.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins) isoform 2, partial [Theobroma cacao] Length = 505 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 7 CRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQKLH 186 CRDFVGKVL K + VSEK DEQLS AEME R+KLLREDSELQKLH Sbjct: 47 CRDFVGKVLAK----------SGEVSEKPTVTYPDEQLSAAEMELRIKLLREDSELQKLH 96 Query: 187 KQFVI 201 KQFV+ Sbjct: 97 KQFVL 101 >ref|XP_007015592.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins), putative isoform 1 [Theobroma cacao] gi|508785955|gb|EOY33211.1| BSD domain (BTF2-like transcription factors, Synapse-associated proteins and DOS2-like proteins), putative isoform 1 [Theobroma cacao] Length = 646 Score = 71.6 bits (174), Expect = 1e-10 Identities = 41/65 (63%), Positives = 44/65 (67%) Frame = +1 Query: 7 CRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQKLH 186 CRDFVGKVL K + VSEK DEQLS AEME R+KLLREDSELQKLH Sbjct: 91 CRDFVGKVLAK----------SGEVSEKPTVTYPDEQLSAAEMELRIKLLREDSELQKLH 140 Query: 187 KQFVI 201 KQFV+ Sbjct: 141 KQFVL 145 >ref|XP_002443866.1| hypothetical protein SORBIDRAFT_07g003540 [Sorghum bicolor] gi|241940216|gb|EES13361.1| hypothetical protein SORBIDRAFT_07g003540 [Sorghum bicolor] Length = 600 Score = 70.9 bits (172), Expect = 2e-10 Identities = 39/67 (58%), Positives = 47/67 (70%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D+CRDFV +VLGK Q + V E S + EQLS AE+ERR+KLLREDSELQK Sbjct: 88 DLCRDFVARVLGKHQG--TVPPRPTVAPENSVASAALEQLSVAEVERRVKLLREDSELQK 145 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 146 LHKKFVL 152 >gb|AFW61225.1| hypothetical protein ZEAMMB73_026868 [Zea mays] Length = 476 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/67 (58%), Positives = 46/67 (68%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D CRDFV +VLGK Q + V E S + EQLS AE+ERR+KLLREDSELQK Sbjct: 88 DQCRDFVARVLGKHQGI--VPPRPTVAPENSVASAALEQLSAAEVERRVKLLREDSELQK 145 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 146 LHKKFVL 152 >gb|AFW61224.1| BSD domain containing protein [Zea mays] Length = 600 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/67 (58%), Positives = 46/67 (68%) Frame = +1 Query: 1 DVCRDFVGKVLGKLQAMQSTGKDAKVVSEKSASIVHDEQLSTAEMERRMKLLREDSELQK 180 D CRDFV +VLGK Q + V E S + EQLS AE+ERR+KLLREDSELQK Sbjct: 88 DQCRDFVARVLGKHQGI--VPPRPTVAPENSVASAALEQLSAAEVERRVKLLREDSELQK 145 Query: 181 LHKQFVI 201 LHK+FV+ Sbjct: 146 LHKKFVL 152