BLASTX nr result
ID: Akebia24_contig00026008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00026008 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, m... 55 3e-08 ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citr... 55 4e-08 ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prun... 60 4e-07 ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutr... 59 5e-07 ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, m... 59 7e-07 ref|XP_004242803.1| PREDICTED: tyrosine--tRNA ligase-like [Solan... 59 7e-07 ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, m... 59 9e-07 ref|XP_004303944.1| PREDICTED: tyrosine--tRNA ligase-like [Fraga... 58 1e-06 ref|XP_004299915.1| PREDICTED: tyrosine--tRNA ligase-like [Fraga... 58 2e-06 ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group] g... 58 2e-06 ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, m... 58 2e-06 gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japo... 58 2e-06 ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [A... 57 2e-06 ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucum... 57 3e-06 ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucum... 57 3e-06 ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phas... 57 3e-06 ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, part... 57 3e-06 ref|XP_002884331.1| tRNA synthetase class I family protein [Arab... 57 3e-06 ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana] ... 57 3e-06 ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, m... 56 4e-06 >ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like [Citrus sinensis] Length = 493 Score = 55.5 bits (132), Expect(2) = 3e-08 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 408 VKVFCGFDPTAEILHLGNLLGIIVLSW 328 +KV+CGFDPTAE LHLGNLLGIIVLSW Sbjct: 100 LKVYCGFDPTAESLHLGNLLGIIVLSW 126 Score = 27.7 bits (60), Expect(2) = 3e-08 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 7/45 (15%) Frame = -3 Query: 236 SGIYIENPIWKVGSAK--ILNLNDVYGDSF-----VTLNNFDWWK 123 SG IE P + + + IL ++ + F V LNN+DWWK Sbjct: 149 SGKSIERPELDIDTLEKNILGISKTFSTIFGSSNVVILNNYDWWK 193 >ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina] gi|557549477|gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina] Length = 493 Score = 55.5 bits (132), Expect(2) = 4e-08 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 408 VKVFCGFDPTAEILHLGNLLGIIVLSW 328 +KV+CGFDPTAE LHLGNLLGIIVLSW Sbjct: 100 LKVYCGFDPTAESLHLGNLLGIIVLSW 126 Score = 27.3 bits (59), Expect(2) = 4e-08 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 7/45 (15%) Frame = -3 Query: 236 SGIYIENPIWKVGSAK--ILNLNDVYGDSF-----VTLNNFDWWK 123 SG IE P + + + IL + + F V LNN+DWWK Sbjct: 149 SGKSIERPELDIDTLEKNILGIRKTFSTIFGSSNVVILNNYDWWK 193 >ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica] gi|462419544|gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica] Length = 485 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 PSL PLKV +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 88 PSLPPLKV--YCGFDPTAESLHLGNLLGIIVLSW 119 >ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum] gi|567203952|ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum] gi|557109540|gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum] gi|557109541|gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum] Length = 499 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 PS++PLKV +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 101 PSVAPLKV--YCGFDPTAESLHLGNLLGIIVLSW 132 >ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like [Solanum tuberosum] Length = 522 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 P+L PLKV +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 106 PNLGPLKV--YCGFDPTAESLHLGNLLGIIVLSW 137 >ref|XP_004242803.1| PREDICTED: tyrosine--tRNA ligase-like [Solanum lycopersicum] Length = 521 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 P+L PLKV +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 105 PNLGPLKV--YCGFDPTAESLHLGNLLGIIVLSW 136 >ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like [Glycine max] Length = 496 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 423 LSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 L+P +KV+CGFDPTAE LHLGNLLG+IVLSW Sbjct: 81 LTPAPLKVYCGFDPTAESLHLGNLLGLIVLSW 112 >ref|XP_004303944.1| PREDICTED: tyrosine--tRNA ligase-like [Fragaria vesca subsp. vesca] Length = 482 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 PS+ PLKV +CGFDPTAE LHLGNLLG+IVLSW Sbjct: 83 PSIPPLKV--YCGFDPTAESLHLGNLLGLIVLSW 114 >ref|XP_004299915.1| PREDICTED: tyrosine--tRNA ligase-like [Fragaria vesca subsp. vesca] Length = 487 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 PS+ PLKV +CGFDPTAE LHLGNLLG+IVLSW Sbjct: 88 PSVPPLKV--YCGFDPTAESLHLGNLLGLIVLSW 119 >ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group] gi|15408650|dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group] gi|113532662|dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group] gi|125526089|gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group] gi|215694904|dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group] Length = 497 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 426 SLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 S SP ++K +CGFDPTAE LHLGNLLG++VLSW Sbjct: 71 SASPRELKAYCGFDPTAESLHLGNLLGLVVLSW 103 >ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like [Glycine max] Length = 490 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 423 LSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 L+P +KV+CGFDPTAE LHLGNLLG+IVLSW Sbjct: 83 LTPPPLKVYCGFDPTAESLHLGNLLGLIVLSW 114 >gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group] Length = 545 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 426 SLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 S SP ++K +CGFDPTAE LHLGNLLG++VLSW Sbjct: 71 SASPRELKAYCGFDPTAESLHLGNLLGLVVLSW 103 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -2 Query: 426 SLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 S SP ++K +CGFDPTAE LHLGNLLG++VLSW Sbjct: 143 SASPRELKAYCGFDPTAESLHLGNLLGLVVLSW 175 >ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda] gi|548830955|gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda] Length = 495 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 P+ SPLKV +CGFDPTAE LHLGNLLG+IVLSW Sbjct: 87 PNSSPLKV--YCGFDPTAESLHLGNLLGLIVLSW 118 >ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus] Length = 493 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 426 SLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 SLSPLKV +CGFDPTA+ LHLGNLLG+IVLSW Sbjct: 90 SLSPLKV--YCGFDPTAQSLHLGNLLGLIVLSW 120 >ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus] Length = 493 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 426 SLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 SLSPLKV +CGFDPTA+ LHLGNLLG+IVLSW Sbjct: 90 SLSPLKV--YCGFDPTAQSLHLGNLLGLIVLSW 120 >ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris] gi|561015195|gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris] Length = 478 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 408 VKVFCGFDPTAEILHLGNLLGIIVLSW 328 VKV+CGFDPTAE LHLGNLLGIIVLSW Sbjct: 79 VKVYCGFDPTAESLHLGNLLGIIVLSW 105 >ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella] gi|482566079|gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella] Length = 548 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 P ++PL+V +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 147 PKVAPLRV--YCGFDPTAESLHLGNLLGIIVLSW 178 >ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. lyrata] gi|297330171|gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. lyrata] Length = 511 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 P ++PL+V +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 110 PKVAPLRV--YCGFDPTAESLHLGNLLGIIVLSW 141 >ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana] gi|6957729|gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana] gi|62320566|dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana] gi|117168055|gb|ABK32110.1| At3g02660 [Arabidopsis thaliana] gi|332640324|gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana] Length = 511 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 429 PSLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 P ++PL+V +CGFDPTAE LHLGNLLGIIVLSW Sbjct: 110 PKVAPLRV--YCGFDPTAESLHLGNLLGIIVLSW 141 >ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like [Oryza brachyantha] Length = 485 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 426 SLSPLKVKVFCGFDPTAEILHLGNLLGIIVLSW 328 S SP ++K +CGFDPTAE LHLGNLLG++ LSW Sbjct: 58 SASPRELKAYCGFDPTAESLHLGNLLGLVALSW 90