BLASTX nr result
ID: Akebia24_contig00025973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00025973 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] 75 1e-11 ref|NP_569676.1| hypothetical protein PsnuCp071 [Psilotum nudum]... 63 5e-08 ref|XP_006837985.1| hypothetical protein AMTR_s00102p00104400 [A... 59 9e-07 >gb|EPS74520.1| hypothetical protein M569_00237 [Genlisea aurea] Length = 173 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 181 KKSFPLGQVVGEEGFEPPTPWFMATCSNPLSYRSHPISTGS 303 ++ FP G VVGEEGFEPPTPWF+AT SNPLSYR HP+STGS Sbjct: 5 ERYFPFGPVVGEEGFEPPTPWFVATRSNPLSYRPHPVSTGS 45 >ref|NP_569676.1| hypothetical protein PsnuCp071 [Psilotum nudum] gi|18860386|ref|NP_569702.1| hypothetical protein PsnuCp097 [Psilotum nudum] gi|18389513|dbj|BAB84265.1| hypothetical protein [Psilotum nudum] gi|18389539|dbj|BAB84291.1| hypothetical protein [Psilotum nudum] Length = 89 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 184 KSFPLGQVVGEEGFEPPTPWFMATCSNPLSYRSH 285 ++F LG ++GEEGFEPPTPWF+ATCS+PLSY+ H Sbjct: 19 RTFALGLIMGEEGFEPPTPWFVATCSDPLSYKPH 52 >ref|XP_006837985.1| hypothetical protein AMTR_s00102p00104400 [Amborella trichopoda] gi|548840400|gb|ERN00554.1| hypothetical protein AMTR_s00102p00104400 [Amborella trichopoda] Length = 81 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 205 VVGEEGFEPPTPWFMATCSNPLSYRSHP 288 VVG+EGFEPPT WF+ATCSNPLSYR HP Sbjct: 44 VVGKEGFEPPTLWFVATCSNPLSYRPHP 71