BLASTX nr result
ID: Akebia24_contig00025898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00025898 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACH48223.1| tumor differentially expressed protein [Haplopelm... 67 2e-09 gb|ADV40298.1| putative tumor differentially expressed protein [... 64 3e-08 dbj|GAA54250.1| tumor differentially expressed protein [Clonorch... 62 1e-07 gb|EKC17917.1| hypothetical protein CGI_10000048 [Crassostrea gi... 61 2e-07 gb|EKC17856.1| hypothetical protein CGI_10000119 [Crassostrea gi... 61 2e-07 gb|EKC17739.1| hypothetical protein CGI_10000276 [Crassostrea gi... 61 2e-07 gb|AEM37715.1| plasminogen [Epinephelus bruneus] 58 1e-06 ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malay... 57 3e-06 ref|XP_003698921.1| PREDICTED: uncharacterized protein LOC100866... 55 8e-06 >gb|ACH48223.1| tumor differentially expressed protein [Haplopelma schmidti] Length = 77 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/48 (68%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = -3 Query: 133 ITLPSISASCWCY----SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 +TL + W SFKCLPYQLSMVGY PTMVVTGNGESGFDSG Sbjct: 27 VTLYNFGLIAWACPGDASFKCLPYQLSMVGYAPTMVVTGNGESGFDSG 74 >gb|ADV40298.1| putative tumor differentially expressed protein [Latrodectus hesperus] Length = 77 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 94 SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 SFKCLPYQLSMV Y PTMVVTGNGESGFDSG Sbjct: 44 SFKCLPYQLSMVCYAPTMVVTGNGESGFDSG 74 >dbj|GAA54250.1| tumor differentially expressed protein [Clonorchis sinensis] Length = 51 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 94 SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 SFKCLPYQ SMVG +PTMV+TGNGESGFDSG Sbjct: 18 SFKCLPYQFSMVGDLPTMVITGNGESGFDSG 48 >gb|EKC17917.1| hypothetical protein CGI_10000048 [Crassostrea gigas] Length = 143 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 94 SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 SFKCLPYQLSMV +PTMVVTGNGESGFDSG Sbjct: 110 SFKCLPYQLSMVRAMPTMVVTGNGESGFDSG 140 >gb|EKC17856.1| hypothetical protein CGI_10000119 [Crassostrea gigas] Length = 154 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 94 SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 SFKCLPYQLSMV +PTMVVTGNGESGFDSG Sbjct: 121 SFKCLPYQLSMVRAMPTMVVTGNGESGFDSG 151 >gb|EKC17739.1| hypothetical protein CGI_10000276 [Crassostrea gigas] gi|405961022|gb|EKC26884.1| hypothetical protein CGI_10000518 [Crassostrea gigas] gi|405969411|gb|EKC34384.1| hypothetical protein CGI_10017687 [Crassostrea gigas] Length = 77 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 94 SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 SFKCLPYQLSMV +PTMVVTGNGESGFDSG Sbjct: 44 SFKCLPYQLSMVRAMPTMVVTGNGESGFDSG 74 >gb|AEM37715.1| plasminogen [Epinephelus bruneus] Length = 81 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 94 SFKCLPYQLSMVGYVPTMVVTGNGESGFDSG 2 SF+CLPYQLSMV VPTMV TGNGESGFDSG Sbjct: 48 SFECLPYQLSMVLSVPTMVTTGNGESGFDSG 78 >ref|XP_001895031.1| hypothetical protein Bm1_17870 [Brugia malayi] gi|158598170|gb|EDP36122.1| hypothetical protein Bm1_17870 [Brugia malayi] Length = 62 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 SGVEP*FSVTRYNHGRHITYHRQLIRQTFE 91 SGVEP FSVTRYNHGRHI YHR+LIRQT + Sbjct: 21 SGVEPLFSVTRYNHGRHINYHRKLIRQTLD 50 >ref|XP_003698921.1| PREDICTED: uncharacterized protein LOC100866091 [Apis florea] Length = 78 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = -3 Query: 115 SASCWCYSFKCLPYQLSMVGYVPTMVVTGNGESG 14 S+S SFKCLPYQLSMVG PTMVVTGNGESG Sbjct: 45 SSSTGDASFKCLPYQLSMVGSAPTMVVTGNGESG 78