BLASTX nr result
ID: Akebia24_contig00025759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00025759 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004985255.1| PREDICTED: vesicle transport protein GOT1B-l... 64 2e-08 gb|EMS60281.1| Protein transport protein GOT1 [Triticum urartu] 63 4e-08 ref|XP_003558530.1| PREDICTED: vesicle transport protein GOT1B-l... 63 4e-08 dbj|BAJ99406.1| predicted protein [Hordeum vulgare subsp. vulgare] 63 4e-08 ref|XP_006650427.1| PREDICTED: vesicle transport protein GOT1B-l... 62 6e-08 ref|XP_002468303.1| hypothetical protein SORBIDRAFT_01g043350 [S... 62 6e-08 ref|NP_001141744.1| hypothetical protein [Zea mays] gi|194705770... 62 6e-08 ref|NP_001150565.1| LOC100284198 [Zea mays] gi|194698124|gb|ACF8... 61 1e-07 ref|XP_004985256.1| PREDICTED: vesicle transport protein GOT1B-l... 61 2e-07 ref|XP_004233186.1| PREDICTED: vesicle transport protein GOT1B-l... 61 2e-07 ref|NP_001049334.1| Os03g0209400 [Oryza sativa Japonica Group] g... 61 2e-07 ref|XP_006428119.1| hypothetical protein CICLE_v10027142mg [Citr... 60 2e-07 gb|EEC66755.1| hypothetical protein OsI_33127 [Oryza sativa Indi... 60 2e-07 ref|XP_002529770.1| Vesicle transport protein GOT1B, putative [R... 60 3e-07 ref|XP_006372936.1| Got1-like family protein [Populus trichocarp... 59 5e-07 ref|XP_006649603.1| PREDICTED: vesicle transport protein GOT1B-l... 59 7e-07 ref|XP_006464292.1| PREDICTED: vesicle transport protein GOT1B-l... 59 7e-07 ref|XP_006838320.1| hypothetical protein AMTR_s00103p00137810 [A... 59 7e-07 ref|XP_004296732.1| PREDICTED: vesicle transport protein GOT1A-l... 59 7e-07 ref|NP_001238720.1| uncharacterized protein LOC100527869 [Glycin... 59 7e-07 >ref|XP_004985255.1| PREDICTED: vesicle transport protein GOT1B-like isoform X3 [Setaria italica] Length = 141 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTSVR 126 SGFWPTL VFLQRIPI+GW+FQQPFVTSVR Sbjct: 101 SGFWPTLVVFLQRIPIIGWIFQQPFVTSVR 130 >gb|EMS60281.1| Protein transport protein GOT1 [Triticum urartu] Length = 163 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQRIPILGW+FQQPFVTS Sbjct: 124 SGFWPTLAVFLQRIPILGWIFQQPFVTS 151 >ref|XP_003558530.1| PREDICTED: vesicle transport protein GOT1B-like [Brachypodium distachyon] Length = 140 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQRIPILGW+FQQPFVTS Sbjct: 101 SGFWPTLAVFLQRIPILGWIFQQPFVTS 128 >dbj|BAJ99406.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 140 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQRIPILGW+FQQPFVTS Sbjct: 101 SGFWPTLAVFLQRIPILGWIFQQPFVTS 128 >ref|XP_006650427.1| PREDICTED: vesicle transport protein GOT1B-like [Oryza brachyantha] Length = 140 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQRIPI+GW+FQQPFVTS Sbjct: 101 SGFWPTLAVFLQRIPIIGWIFQQPFVTS 128 >ref|XP_002468303.1| hypothetical protein SORBIDRAFT_01g043350 [Sorghum bicolor] gi|241922157|gb|EER95301.1| hypothetical protein SORBIDRAFT_01g043350 [Sorghum bicolor] Length = 140 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQRIPI+GW+FQQPFVTS Sbjct: 101 SGFWPTLAVFLQRIPIIGWIFQQPFVTS 128 >ref|NP_001141744.1| hypothetical protein [Zea mays] gi|194705770|gb|ACF86969.1| unknown [Zea mays] gi|413956614|gb|AFW89263.1| hypothetical protein ZEAMMB73_222423 [Zea mays] gi|413956615|gb|AFW89264.1| hypothetical protein ZEAMMB73_222423 [Zea mays] Length = 140 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQRIPI+GW+FQQPFVTS Sbjct: 101 SGFWPTLAVFLQRIPIIGWIFQQPFVTS 128 >ref|NP_001150565.1| LOC100284198 [Zea mays] gi|194698124|gb|ACF83146.1| unknown [Zea mays] gi|195640240|gb|ACG39588.1| golgi transport 1 protein B [Zea mays] gi|414865304|tpg|DAA43861.1| TPA: golgi transport 1 protein B [Zea mays] Length = 140 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTL+VFLQRIPI+GW+FQQPFVTS Sbjct: 101 SGFWPTLSVFLQRIPIIGWIFQQPFVTS 128 >ref|XP_004985256.1| PREDICTED: vesicle transport protein GOT1B-like isoform X4 [Setaria italica] Length = 140 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTL VFLQRIPI+GW+FQQPFVTS Sbjct: 101 SGFWPTLVVFLQRIPIIGWIFQQPFVTS 128 >ref|XP_004233186.1| PREDICTED: vesicle transport protein GOT1B-like isoform 1 [Solanum lycopersicum] Length = 151 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTSVRILCTRITF 102 SGFWPTLAVFLQ+IPILGW+FQQP++ SV ++ I + Sbjct: 101 SGFWPTLAVFLQKIPILGWIFQQPYIRSVCLIALFILY 138 >ref|NP_001049334.1| Os03g0209400 [Oryza sativa Japonica Group] gi|108706782|gb|ABF94577.1| Got1-like family protein, expressed [Oryza sativa Japonica Group] gi|113547805|dbj|BAF11248.1| Os03g0209400 [Oryza sativa Japonica Group] gi|215765455|dbj|BAG87152.1| unnamed protein product [Oryza sativa Japonica Group] gi|222624427|gb|EEE58559.1| hypothetical protein OsJ_09864 [Oryza sativa Japonica Group] Length = 140 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTL VFLQRIPI+GW+FQQPFVTS Sbjct: 101 SGFWPTLVVFLQRIPIIGWIFQQPFVTS 128 >ref|XP_006428119.1| hypothetical protein CICLE_v10027142mg [Citrus clementina] gi|557530109|gb|ESR41359.1| hypothetical protein CICLE_v10027142mg [Citrus clementina] Length = 132 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTSV 129 SGFWPTL+VFLQRIPILGW+FQQPFV SV Sbjct: 101 SGFWPTLSVFLQRIPILGWLFQQPFVRSV 129 >gb|EEC66755.1| hypothetical protein OsI_33127 [Oryza sativa Indica Group] Length = 142 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTSVRILCT 114 SGFWPTL VFLQ+IP +GW+FQQPFV SV+I T Sbjct: 101 SGFWPTLVVFLQKIPFIGWIFQQPFVASVQIFPT 134 >ref|XP_002529770.1| Vesicle transport protein GOT1B, putative [Ricinus communis] gi|223530768|gb|EEF32636.1| Vesicle transport protein GOT1B, putative [Ricinus communis] Length = 163 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVF+QRIPILGWVFQQPF+ S Sbjct: 101 SGFWPTLAVFMQRIPILGWVFQQPFIRS 128 >ref|XP_006372936.1| Got1-like family protein [Populus trichocarpa] gi|550319584|gb|ERP50733.1| Got1-like family protein [Populus trichocarpa] Length = 140 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVF+Q+IPILGWVFQQPFV S Sbjct: 101 SGFWPTLAVFIQKIPILGWVFQQPFVRS 128 >ref|XP_006649603.1| PREDICTED: vesicle transport protein GOT1B-like [Oryza brachyantha] Length = 140 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTL VFLQRIPI+GW+F QPFVTS Sbjct: 101 SGFWPTLVVFLQRIPIIGWIFHQPFVTS 128 >ref|XP_006464292.1| PREDICTED: vesicle transport protein GOT1B-like isoform X1 [Citrus sinensis] gi|568819510|ref|XP_006464293.1| PREDICTED: vesicle transport protein GOT1B-like isoform X2 [Citrus sinensis] Length = 140 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTL+VFLQRIPILGW+FQQPFV S Sbjct: 101 SGFWPTLSVFLQRIPILGWLFQQPFVRS 128 >ref|XP_006838320.1| hypothetical protein AMTR_s00103p00137810 [Amborella trichopoda] gi|548840788|gb|ERN00889.1| hypothetical protein AMTR_s00103p00137810 [Amborella trichopoda] Length = 160 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPT+AVF+QRIPILGW+FQQPFV S Sbjct: 121 SGFWPTVAVFVQRIPILGWIFQQPFVAS 148 >ref|XP_004296732.1| PREDICTED: vesicle transport protein GOT1A-like [Fragaria vesca subsp. vesca] Length = 140 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTS 132 SGFWPTLAVFLQ+IPILGWVFQQP+V S Sbjct: 101 SGFWPTLAVFLQKIPILGWVFQQPYVRS 128 >ref|NP_001238720.1| uncharacterized protein LOC100527869 [Glycine max] gi|571437901|ref|XP_006574378.1| PREDICTED: uncharacterized protein LOC100527869 isoform X1 [Glycine max] gi|255633428|gb|ACU17072.1| unknown [Glycine max] Length = 140 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 215 SGFWPTLAVFLQRIPILGWVFQQPFVTSV 129 SGFWPTLAVFLQ+IP+LGW+FQQPFV S+ Sbjct: 101 SGFWPTLAVFLQKIPVLGWLFQQPFVRSL 129