BLASTX nr result
ID: Akebia24_contig00025730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00025730 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citr... 56 5e-06 ref|XP_006422775.1| hypothetical protein CICLE_v10028360mg [Citr... 56 5e-06 ref|XP_006486896.1| PREDICTED: serine carboxypeptidase-like 18-l... 56 6e-06 >ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citrus clementina] gi|557524711|gb|ESR36017.1| hypothetical protein CICLE_v10028360mg [Citrus clementina] Length = 470 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 338 LSNPLYVGGDSYSGMIVPIIVQHISDGNPLNH 243 L+NPLY+GGDSYSG+IVP+IVQHISDG + H Sbjct: 165 LANPLYIGGDSYSGIIVPMIVQHISDGIDVGH 196 >ref|XP_006422775.1| hypothetical protein CICLE_v10028360mg [Citrus clementina] gi|567860244|ref|XP_006422776.1| hypothetical protein CICLE_v10028360mg [Citrus clementina] gi|557524709|gb|ESR36015.1| hypothetical protein CICLE_v10028360mg [Citrus clementina] gi|557524710|gb|ESR36016.1| hypothetical protein CICLE_v10028360mg [Citrus clementina] Length = 330 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 338 LSNPLYVGGDSYSGMIVPIIVQHISDGNPLNH 243 L+NPLY+GGDSYSG+IVP+IVQHISDG + H Sbjct: 25 LANPLYIGGDSYSGIIVPMIVQHISDGIDVGH 56 >ref|XP_006486896.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis] Length = 470 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = -3 Query: 338 LSNPLYVGGDSYSGMIVPIIVQHISDGNPLNH 243 L+NPLY+GGDSYSG+IVP+IVQH+SDG + H Sbjct: 165 LANPLYIGGDSYSGIIVPMIVQHVSDGIDVGH 196