BLASTX nr result
ID: Akebia24_contig00025614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00025614 (229 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516852.1| hypothetical protein GlmaxMp02 (mitochondrio... 114 2e-23 >ref|YP_007516852.1| hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] gi|403311585|gb|AFR34333.1| hypothetical protein GlmaxMp02 (mitochondrion) [Glycine max] Length = 104 Score = 114 bits (284), Expect = 2e-23 Identities = 56/64 (87%), Positives = 57/64 (89%), Gaps = 2/64 (3%) Frame = +3 Query: 42 KRDSIQICHSLGDAFFLC--PPLNDELCQSSPPTRPGENTRSSQALTRLNGIHISFVWSR 215 +RDSIQICHSLGDA F PPLNDELCQSSPPTRPGENT SSQALTR NGIHISFVWSR Sbjct: 29 ERDSIQICHSLGDALFSMNTPPLNDELCQSSPPTRPGENTESSQALTRQNGIHISFVWSR 88 Query: 216 REKA 227 REKA Sbjct: 89 REKA 92