BLASTX nr result
ID: Akebia24_contig00025461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00025461 (503 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143214.1| PREDICTED: cell division control protein 6 h... 66 6e-09 ref|XP_002525621.1| cdc6, putative [Ricinus communis] gi|2235350... 64 2e-08 ref|XP_002299817.2| hypothetical protein POPTR_0001s25730g [Popu... 64 3e-08 ref|XP_006602103.1| PREDICTED: cell division control protein 6 h... 63 4e-08 ref|XP_004506723.1| PREDICTED: cell division control protein 6 h... 63 4e-08 ref|XP_006586192.1| PREDICTED: cell division control protein 6 h... 63 5e-08 ref|XP_007016145.1| Cell division control 6 isoform 7 [Theobroma... 63 5e-08 ref|XP_007016144.1| Cell division control 6 isoform 6, partial [... 63 5e-08 ref|XP_007016143.1| Cell division control 6 isoform 5 [Theobroma... 63 5e-08 ref|XP_007016142.1| Cell division control 6 isoform 4, partial [... 63 5e-08 ref|XP_007016141.1| Cell division control 6 isoform 3 [Theobroma... 63 5e-08 ref|XP_007016140.1| Cell division control, Cdc6 isoform 2 [Theob... 63 5e-08 ref|XP_007016139.1| Cell division control, Cdc6 isoform 1 [Theob... 63 5e-08 ref|XP_004500243.1| PREDICTED: cell division control protein 6 h... 62 6e-08 ref|XP_007146723.1| hypothetical protein PHAVU_006G064300g [Phas... 62 1e-07 gb|AFW84516.1| hypothetical protein ZEAMMB73_335801 [Zea mays] 62 1e-07 ref|XP_004295745.1| PREDICTED: cell division control protein 6 h... 61 1e-07 ref|XP_007207971.1| hypothetical protein PRUPE_ppa016348mg [Prun... 61 2e-07 ref|XP_003632136.1| PREDICTED: cell division control protein 6 h... 60 2e-07 emb|CBI15981.3| unnamed protein product [Vitis vinifera] 60 2e-07 >ref|XP_004143214.1| PREDICTED: cell division control protein 6 homolog [Cucumis sativus] gi|449520665|ref|XP_004167354.1| PREDICTED: cell division control protein 6 homolog [Cucumis sativus] Length = 500 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -1 Query: 362 KLIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 KLIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ A+ L Sbjct: 222 KLIIADELDYLITKDKAVLHDLFMLTTFPFSRCILIGIANAIDL 265 >ref|XP_002525621.1| cdc6, putative [Ricinus communis] gi|223535057|gb|EEF36739.1| cdc6, putative [Ricinus communis] Length = 523 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ A+ L Sbjct: 225 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANAIDL 267 >ref|XP_002299817.2| hypothetical protein POPTR_0001s25730g [Populus trichocarpa] gi|550348176|gb|EEE84622.2| hypothetical protein POPTR_0001s25730g [Populus trichocarpa] Length = 494 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -1 Query: 368 RDKLIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 + KLIIADELDYLITKD+ VL+D FM TTF FS+CILI ++ A+ L Sbjct: 215 QQKLIIADELDYLITKDRAVLYDLFMLTTFPFSRCILIGVANAIDL 260 >ref|XP_006602103.1| PREDICTED: cell division control protein 6 homolog [Glycine max] Length = 536 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LI+ADELDYLITKD+ VLHD FM TTF FS+CILI ++ A+ L Sbjct: 256 LIVADELDYLITKDRAVLHDLFMLTTFPFSRCILIGVANAIDL 298 >ref|XP_004506723.1| PREDICTED: cell division control protein 6 homolog [Cicer arietinum] Length = 482 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LI+ADELDYLITKD+ VLHD FM TTF FS+CILI ++ A+ L Sbjct: 202 LIVADELDYLITKDRAVLHDLFMLTTFPFSRCILIGVANAIDL 244 >ref|XP_006586192.1| PREDICTED: cell division control protein 6 homolog [Glycine max] Length = 493 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LI+ADELDYLITKD+ VLHD FM TTF FS+CILI ++ A+ L Sbjct: 213 LIVADELDYLITKDRGVLHDLFMLTTFPFSRCILIGVANAIDL 255 >ref|XP_007016145.1| Cell division control 6 isoform 7 [Theobroma cacao] gi|508786508|gb|EOY33764.1| Cell division control 6 isoform 7 [Theobroma cacao] Length = 417 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 230 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 272 >ref|XP_007016144.1| Cell division control 6 isoform 6, partial [Theobroma cacao] gi|508786507|gb|EOY33763.1| Cell division control 6 isoform 6, partial [Theobroma cacao] Length = 452 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 230 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 272 >ref|XP_007016143.1| Cell division control 6 isoform 5 [Theobroma cacao] gi|508786506|gb|EOY33762.1| Cell division control 6 isoform 5 [Theobroma cacao] Length = 418 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 231 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 273 >ref|XP_007016142.1| Cell division control 6 isoform 4, partial [Theobroma cacao] gi|508786505|gb|EOY33761.1| Cell division control 6 isoform 4, partial [Theobroma cacao] Length = 485 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 231 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 273 >ref|XP_007016141.1| Cell division control 6 isoform 3 [Theobroma cacao] gi|508786504|gb|EOY33760.1| Cell division control 6 isoform 3 [Theobroma cacao] Length = 456 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 231 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 273 >ref|XP_007016140.1| Cell division control, Cdc6 isoform 2 [Theobroma cacao] gi|508786503|gb|EOY33759.1| Cell division control, Cdc6 isoform 2 [Theobroma cacao] Length = 510 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 230 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 272 >ref|XP_007016139.1| Cell division control, Cdc6 isoform 1 [Theobroma cacao] gi|508786502|gb|EOY33758.1| Cell division control, Cdc6 isoform 1 [Theobroma cacao] Length = 511 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLITKD+ VLHD FM TTF FS+CILI ++ ++ L Sbjct: 231 LIIADELDYLITKDRAVLHDLFMLTTFPFSRCILIGIANSIDL 273 >ref|XP_004500243.1| PREDICTED: cell division control protein 6 homolog [Cicer arietinum] Length = 482 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 L++ADELDYLITKD+ VLHD FM TTF FS+CILI ++ A+ L Sbjct: 202 LLVADELDYLITKDRAVLHDLFMLTTFPFSRCILIGVANAIDL 244 >ref|XP_007146723.1| hypothetical protein PHAVU_006G064300g [Phaseolus vulgaris] gi|561019946|gb|ESW18717.1| hypothetical protein PHAVU_006G064300g [Phaseolus vulgaris] Length = 549 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LI+ADELDYLITKD+ VLH+ FM TTF FS+CILI ++ A+ L Sbjct: 268 LIVADELDYLITKDRAVLHELFMLTTFPFSRCILIGVANAIDL 310 >gb|AFW84516.1| hypothetical protein ZEAMMB73_335801 [Zea mays] Length = 490 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -1 Query: 395 FMNLIIAYFRDKLIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 F N +A R L+I DE+DYLIT+D+ VLHD FM TT+ FS+CILI ++ A+ L Sbjct: 217 FSNKDLAPRRMMLVIVDEMDYLITRDRAVLHDLFMLTTYPFSRCILIGIANAIDL 271 >ref|XP_004295745.1| PREDICTED: cell division control protein 6 homolog [Fragaria vesca subsp. vesca] Length = 564 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 L+IADELDYLITKD+ VLHD FM TT+ FS+CIL+ ++ A+ L Sbjct: 282 LVIADELDYLITKDRAVLHDLFMLTTYPFSRCILLGVANAIDL 324 >ref|XP_007207971.1| hypothetical protein PRUPE_ppa016348mg [Prunus persica] gi|462403613|gb|EMJ09170.1| hypothetical protein PRUPE_ppa016348mg [Prunus persica] Length = 482 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELD+LITKD+ VLHD FM TT+ FS+CILI ++ A+ L Sbjct: 201 LIIADELDFLITKDRAVLHDLFMLTTYPFSRCILIGVANAIDL 243 >ref|XP_003632136.1| PREDICTED: cell division control protein 6 homolog [Vitis vinifera] Length = 497 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLIT+D+ VLHD FM TT FS CILI +S A+ L Sbjct: 229 LIIADELDYLITRDRTVLHDLFMLTTLPFSSCILIGVSNAIDL 271 >emb|CBI15981.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 359 LIIADELDYLITKDQFVLHDFFMFTTFLFSKCILIRLSLALQL 231 LIIADELDYLIT+D+ VLHD FM TT FS CILI +S A+ L Sbjct: 229 LIIADELDYLITRDRTVLHDLFMLTTLPFSSCILIGVSNAIDL 271