BLASTX nr result
ID: Akebia24_contig00024864
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024864 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004714120.1| PREDICTED: zinc finger CCCH domain-containin... 53 2e-07 gb|EFA81560.1| hypothetical protein PPL_05549 [Polysphondylium p... 52 2e-06 ref|XP_001969793.1| GG10289 [Drosophila erecta] gi|190661660|gb|... 46 6e-06 >ref|XP_004714120.1| PREDICTED: zinc finger CCCH domain-containing protein 13 [Echinops telfairi] Length = 1649 Score = 53.1 bits (126), Expect(2) = 2e-07 Identities = 29/67 (43%), Positives = 40/67 (59%) Frame = -3 Query: 673 DLSRETNRSDKRGYKINRGRQRKIEGSIEKETVREREMERSIERDSEKEREREIVGETKS 494 D RE R +R + R R+R+ E +E+E RERE ER ERD E+ERER+ E + Sbjct: 680 DRDREREREREREREREREREREKERELERERAREREREREKERDRERERERDHERERER 739 Query: 493 EIVRERQ 473 E RE++ Sbjct: 740 EREREKE 746 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 494 RDCERETVKERSWARLCMREREKER-VKNVVDRPWNFK 384 RD ERE +ER R REREKER ++ R W K Sbjct: 762 RDREREREREREREREREREREKERELERERQREWEDK 799 >gb|EFA81560.1| hypothetical protein PPL_05549 [Polysphondylium pallidum PN500] Length = 954 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 30/67 (44%), Positives = 40/67 (59%) Frame = -3 Query: 673 DLSRETNRSDKRGYKINRGRQRKIEGSIEKETVREREMERSIERDSEKEREREIVGETKS 494 +L RE R +R + + R+R+ E E+E RERE ER ER+ EKERERE E + Sbjct: 584 ELEREKERLREREAEREKEREREREREREREKEREREREREREREREKERERETEREKER 643 Query: 493 EIVRERQ 473 E RER+ Sbjct: 644 ERERERE 650 Score = 26.6 bits (57), Expect(2) = 2e-06 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 497 KRDCERETVKERSWARLCMREREKERVK 414 +R+ ERE +ER R RERE+ER K Sbjct: 644 EREREREREREREKEREREREREREREK 671 >ref|XP_001969793.1| GG10289 [Drosophila erecta] gi|190661660|gb|EDV58852.1| GG10289 [Drosophila erecta] Length = 956 Score = 45.8 bits (107), Expect(2) = 6e-06 Identities = 25/64 (39%), Positives = 39/64 (60%) Frame = -3 Query: 664 RETNRSDKRGYKINRGRQRKIEGSIEKETVREREMERSIERDSEKEREREIVGETKSEIV 485 R+ S R + + GR+R++ E+E RERE +R ERD ++E+ERE E + E + Sbjct: 101 RDARESSNRDKERDSGRERELLREKERERERERERDRERERDRDREKERE--REREKERL 158 Query: 484 RERQ 473 RER+ Sbjct: 159 RERE 162 Score = 30.8 bits (68), Expect(2) = 6e-06 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 497 KRDCERETVKERSWARLCMREREKERVKNVVDRP 396 +R+ E+E +KER RL RERE+ER + + P Sbjct: 165 EREREKERLKEREKERLRERERERERERELTAPP 198