BLASTX nr result
ID: Akebia24_contig00024527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00024527 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510609.1| conserved hypothetical protein [Ricinus comm... 92 9e-17 ref|XP_004291318.1| PREDICTED: F-box protein SKIP23-like [Fragar... 92 1e-16 ref|XP_007222965.1| hypothetical protein PRUPE_ppa006772mg [Prun... 90 5e-16 ref|XP_002300676.1| hypothetical protein POPTR_0002s01710g [Popu... 86 5e-15 ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis ... 86 9e-15 emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] 86 9e-15 ref|XP_002510608.1| conserved hypothetical protein [Ricinus comm... 83 6e-14 ref|XP_002300674.2| hypothetical protein POPTR_0002s01590g [Popu... 80 5e-13 ref|XP_007017940.1| F-box family protein with a domain of Unchar... 79 8e-13 ref|XP_006473738.1| PREDICTED: F-box protein SKIP23-like [Citrus... 75 9e-12 ref|XP_006435277.1| hypothetical protein CICLE_v10001350mg [Citr... 75 9e-12 ref|XP_004238401.1| PREDICTED: F-box protein SKIP23-like [Solanu... 74 2e-11 ref|XP_006342093.1| PREDICTED: F-box protein SKIP23-like isoform... 74 3e-11 ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus ... 74 3e-11 gb|ADN34130.1| ubiquitin-protein ligase [Cucumis melo subsp. melo] 72 8e-11 gb|ACU18186.1| unknown [Glycine max] 71 2e-10 ref|XP_002510612.1| conserved hypothetical protein [Ricinus comm... 67 3e-09 ref|XP_004145529.1| PREDICTED: F-box protein SKIP23-like [Cucumi... 66 7e-09 ref|XP_004292164.1| PREDICTED: F-box protein At2g17036-like [Fra... 65 9e-09 dbj|BAD46645.1| hypothetical protein [Oryza sativa Japonica Grou... 65 9e-09 >ref|XP_002510609.1| conserved hypothetical protein [Ricinus communis] gi|223551310|gb|EEF52796.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 92.0 bits (227), Expect = 9e-17 Identities = 39/76 (51%), Positives = 54/76 (71%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M SWS LP++LL I+++ T DY+ AVC SW SA+P+KPH L C++PWL+LP+ D Sbjct: 1 MSSWSELPQELLQTITQKQTNYVDYISTRAVCKSWWSAIPKKPHDLLCRLPWLLLPHHKD 60 Query: 519 DTPHRDFFNPSNNKVY 566 + HR F+NPS+ K Y Sbjct: 61 NPNHRGFYNPSDGKTY 76 >ref|XP_004291318.1| PREDICTED: F-box protein SKIP23-like [Fragaria vesca subsp. vesca] Length = 398 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/73 (52%), Positives = 54/73 (73%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 W+ LP +L+ ISK+LTI ADY+RF VCH WQ+++P+ P+ LP Q+PWLMLP + Sbjct: 6 WTQLPPELVESISKKLTIFADYLRFRCVCHGWQASIPKTPNHLPPQLPWLMLPQSQPNQS 65 Query: 528 HRDFFNPSNNKVY 566 HR F+N SN++V+ Sbjct: 66 HRAFYNLSNSRVH 78 >ref|XP_007222965.1| hypothetical protein PRUPE_ppa006772mg [Prunus persica] gi|462419901|gb|EMJ24164.1| hypothetical protein PRUPE_ppa006772mg [Prunus persica] Length = 396 Score = 89.7 bits (221), Expect = 5e-16 Identities = 38/73 (52%), Positives = 52/73 (71%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 W+ LP +L+ I+K+LTI ADY+RF VCHSW + +P+ P LP Q+PWLMLP + Sbjct: 5 WTQLPPELVESIAKKLTIYADYLRFRVVCHSWLACVPKTPQHLPPQLPWLMLPQSQPNQT 64 Query: 528 HRDFFNPSNNKVY 566 HR FFN SN++V+ Sbjct: 65 HRAFFNLSNSRVH 77 >ref|XP_002300676.1| hypothetical protein POPTR_0002s01710g [Populus trichocarpa] gi|222842402|gb|EEE79949.1| hypothetical protein POPTR_0002s01710g [Populus trichocarpa] Length = 305 Score = 86.3 bits (212), Expect = 5e-15 Identities = 38/76 (50%), Positives = 53/76 (69%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M WS+LP +LL I+++ T DY+ AVC SW+SALP+KPH L CQ+PWL+LP ++D Sbjct: 1 MSRWSDLPPELLQLITQKQTNYVDYLCVRAVCKSWRSALPKKPHDLLCQLPWLLLPYQND 60 Query: 519 DTPHRDFFNPSNNKVY 566 HR F+N ++ K Y Sbjct: 61 SPNHRGFYNLADGKTY 76 >ref|XP_002284795.1| PREDICTED: F-box protein SKIP23-like [Vitis vinifera] Length = 389 Score = 85.5 bits (210), Expect = 9e-15 Identities = 38/76 (50%), Positives = 50/76 (65%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M WS L +LL I+K+ I DYVRF AVCH+W++++P+ PH LP Q+PWLMLP Sbjct: 1 MADWSQLHPELLDFIAKKFKIYTDYVRFRAVCHNWRASVPKTPHHLPTQLPWLMLPQSQP 60 Query: 519 DTPHRDFFNPSNNKVY 566 HR FF+ S NK + Sbjct: 61 HHTHRPFFSLSLNKFH 76 >emb|CAN69116.1| hypothetical protein VITISV_031843 [Vitis vinifera] Length = 389 Score = 85.5 bits (210), Expect = 9e-15 Identities = 38/76 (50%), Positives = 50/76 (65%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M WS L +LL I+K+ I DYVRF AVCH+W++++P+ PH LP Q+PWLMLP Sbjct: 1 MADWSQLHPELLDFIAKKFKIYTDYVRFRAVCHNWRASVPKTPHHLPTQLPWLMLPQSQP 60 Query: 519 DTPHRDFFNPSNNKVY 566 HR FF+ S NK + Sbjct: 61 HHTHRPFFSLSLNKFH 76 >ref|XP_002510608.1| conserved hypothetical protein [Ricinus communis] gi|223551309|gb|EEF52795.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 82.8 bits (203), Expect = 6e-14 Identities = 35/76 (46%), Positives = 52/76 (68%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M +WS LP++LL I+++ + DY+ AVC SW SA+P+KPH L CQ+PWL+LP + Sbjct: 1 MSNWSELPQELLQTITQKQSNYVDYISTRAVCKSWWSAIPKKPHDLLCQLPWLLLPYHKN 60 Query: 519 DTPHRDFFNPSNNKVY 566 + HR F+N ++ K Y Sbjct: 61 NPNHRGFYNLADGKTY 76 >ref|XP_002300674.2| hypothetical protein POPTR_0002s01590g [Populus trichocarpa] gi|550344063|gb|EEE79947.2| hypothetical protein POPTR_0002s01590g [Populus trichocarpa] Length = 393 Score = 79.7 bits (195), Expect = 5e-13 Identities = 34/74 (45%), Positives = 55/74 (74%), Gaps = 1/74 (1%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLP-NKDDDT 524 W+ LP +L+ ISK++TI +DY+ F AVCH+W+S++P+ P+ LP Q+PWL+LP ++ + + Sbjct: 5 WTQLPPELIEIISKKITIYSDYLHFQAVCHAWKSSIPKTPNHLPPQLPWLLLPQSQSNQS 64 Query: 525 PHRDFFNPSNNKVY 566 +R FFN S K + Sbjct: 65 SYRAFFNLSTYKFH 78 >ref|XP_007017940.1| F-box family protein with a domain of Uncharacterized protein function, putative [Theobroma cacao] gi|508723268|gb|EOY15165.1| F-box family protein with a domain of Uncharacterized protein function, putative [Theobroma cacao] Length = 395 Score = 79.0 bits (193), Expect = 8e-13 Identities = 34/66 (51%), Positives = 45/66 (68%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 W+ LP +LL IS+ L I ADY+RF AVC SW+S++P+ P LP Q+PWLMLP Sbjct: 5 WTQLPPELLQSISENLKIYADYIRFRAVCRSWRSSIPKTPFHLPPQLPWLMLPPSQSHQS 64 Query: 528 HRDFFN 545 HR F++ Sbjct: 65 HRAFYD 70 >ref|XP_006473738.1| PREDICTED: F-box protein SKIP23-like [Citrus sinensis] Length = 406 Score = 75.5 bits (184), Expect = 9e-12 Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLP---NKDD 518 W+ LP +L+ ISK+L +DY+RF VC +W+ ++P+ P+ LP Q+PWLMLP ++ Sbjct: 7 WTELPAELIEAISKKLKFYSDYIRFQRVCRNWRLSIPKTPNHLPPQLPWLMLPQSQSQSQ 66 Query: 519 DTPHRDFFNPSNNKVY 566 H FFN S NKV+ Sbjct: 67 SQTHCAFFNLSANKVH 82 >ref|XP_006435277.1| hypothetical protein CICLE_v10001350mg [Citrus clementina] gi|557537399|gb|ESR48517.1| hypothetical protein CICLE_v10001350mg [Citrus clementina] Length = 406 Score = 75.5 bits (184), Expect = 9e-12 Identities = 34/76 (44%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLP---NKDD 518 W+ LP +L+ ISK+L +DY+RF VC +W+ ++P+ P+ LP Q+PWLMLP ++ Sbjct: 7 WTELPAELIEAISKKLKFYSDYIRFQRVCRNWRLSIPKTPNHLPPQLPWLMLPQSQSQSQ 66 Query: 519 DTPHRDFFNPSNNKVY 566 H FFN S NKV+ Sbjct: 67 SQTHCAFFNLSANKVH 82 >ref|XP_004238401.1| PREDICTED: F-box protein SKIP23-like [Solanum lycopersicum] Length = 402 Score = 74.3 bits (181), Expect = 2e-11 Identities = 36/73 (49%), Positives = 46/73 (63%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 WS LP +LL I ++ DY+ F AVC SW+S+ P P LPCQ+PWLMLP + T Sbjct: 13 WSELPPELLDAIVNKIIDLRDYLHFRAVCPSWRSSTPATPKNLPCQLPWLMLPK--NQTN 70 Query: 528 HRDFFNPSNNKVY 566 R FFN +NKV+ Sbjct: 71 RRGFFNFVDNKVH 83 >ref|XP_006342093.1| PREDICTED: F-box protein SKIP23-like isoform X1 [Solanum tuberosum] gi|565350271|ref|XP_006342094.1| PREDICTED: F-box protein SKIP23-like isoform X2 [Solanum tuberosum] Length = 402 Score = 73.9 bits (180), Expect = 3e-11 Identities = 36/73 (49%), Positives = 45/73 (61%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 WS LP +LL I +L DY+ F AVC SW+S+ P P LPCQ+PWLMLP + Sbjct: 13 WSELPPELLDTIVNKLIDLRDYLHFRAVCPSWRSSTPATPKNLPCQLPWLMLPKNQSN-- 70 Query: 528 HRDFFNPSNNKVY 566 R FFN +NKV+ Sbjct: 71 RRGFFNFVDNKVH 83 >ref|XP_002510618.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551319|gb|EEF52805.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 398 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/75 (46%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDT- 524 WS LP +L+ ISK LTI +DY+ AVCH+W+ ++P+ P+ LP Q+PWLMLP + Sbjct: 5 WSQLPPELIEIISKGLTIYSDYLYSRAVCHAWRFSIPKTPNHLPPQLPWLMLPQSQSQSN 64 Query: 525 -PHRDFFNPSNNKVY 566 R FF+ S NK + Sbjct: 65 QSRRAFFSLSTNKFH 79 >gb|ADN34130.1| ubiquitin-protein ligase [Cucumis melo subsp. melo] Length = 392 Score = 72.4 bits (176), Expect = 8e-11 Identities = 35/76 (46%), Positives = 50/76 (65%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M W+ LP DLL +IS LT+ +DY+RF VC SW+S++P+ PH LP Q+P L++P D Sbjct: 1 MADWTELPPDLLQQISDYLTVYSDYLRFRVVCQSWRSSVPKIPHRLPPQLPCLIIPLYHD 60 Query: 519 DTPHRDFFNPSNNKVY 566 FN S+NK++ Sbjct: 61 --CRCGLFNFSDNKIH 74 >gb|ACU18186.1| unknown [Glycine max] Length = 226 Score = 70.9 bits (172), Expect = 2e-10 Identities = 36/73 (49%), Positives = 46/73 (63%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 W LP +LL ISK LTI DY+RF +VC SW+S++P+ P LP Q+PWLML Sbjct: 5 WGELPPELLESISKTLTIYVDYLRFRSVCRSWRSSVPKIPLHLPPQLPWLML-------S 57 Query: 528 HRDFFNPSNNKVY 566 R FF+ S NK + Sbjct: 58 RRAFFDLSLNKTH 70 >ref|XP_002510612.1| conserved hypothetical protein [Ricinus communis] gi|223551313|gb|EEF52799.1| conserved hypothetical protein [Ricinus communis] Length = 402 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/75 (42%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Frame = +3 Query: 345 SWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPH-CLPCQVPWLMLPNKDDD 521 +W+ LP +LL I+ + T DY+ AVC SWQSA+ ++PH L CQ+P+L+LP ++ Sbjct: 4 TWAELPPELLQVIADKHTNYVDYLVTRAVCGSWQSAIAKRPHNHLLCQLPFLLLPYYQNN 63 Query: 522 TPHRDFFNPSNNKVY 566 R F+N S++K+Y Sbjct: 64 PDRRGFYNISDDKIY 78 >ref|XP_004145529.1| PREDICTED: F-box protein SKIP23-like [Cucumis sativus] gi|449485151|ref|XP_004157083.1| PREDICTED: F-box protein SKIP23-like [Cucumis sativus] Length = 392 Score = 65.9 bits (159), Expect = 7e-09 Identities = 32/76 (42%), Positives = 49/76 (64%) Frame = +3 Query: 339 MGSWSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDD 518 M W+ LP DLL +IS LT+ +DY+RF VC +W+ ++P+ PH LP Q+P L++P + Sbjct: 1 MADWTELPPDLLHQISDYLTVYSDYLRFRVVCWNWRFSVPKIPHRLPPQLPCLIIPLYHN 60 Query: 519 DTPHRDFFNPSNNKVY 566 FN S+NK++ Sbjct: 61 --CRCGLFNFSDNKIH 74 >ref|XP_004292164.1| PREDICTED: F-box protein At2g17036-like [Fragaria vesca subsp. vesca] Length = 417 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/72 (43%), Positives = 48/72 (66%) Frame = +3 Query: 351 SNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTPH 530 +NLP+DLLV I++R+ D++ F AVC SW SA + QVPWLM+P+ ++DT Sbjct: 53 ANLPQDLLVSIAQRVVSFEDFIHFGAVCKSWSSAAIKDNFSRTQQVPWLMIPD-NEDTTI 111 Query: 531 RDFFNPSNNKVY 566 R+F++ +K+Y Sbjct: 112 REFYDLKKDKIY 123 >dbj|BAD46645.1| hypothetical protein [Oryza sativa Japonica Group] gi|52076139|dbj|BAD46652.1| hypothetical protein [Oryza sativa Japonica Group] Length = 861 Score = 65.5 bits (158), Expect = 9e-09 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = +3 Query: 348 WSNLPKDLLVEISKRLTINADYVRFHAVCHSWQSALPEKPHCLPCQVPWLMLPNKDDDTP 527 W++LP DLL +IS+RL AD+ RFHAVC SW+ LP P P +PWL+ P D T Sbjct: 39 WADLPFDLLADISRRLHATADFARFHAVCKSWRRTLPPHP---PTFLPWLLSPG--DATG 93 Query: 528 HR 533 HR Sbjct: 94 HR 95