BLASTX nr result
ID: Akebia24_contig00023761
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00023761 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518274.1| conserved hypothetical protein [Ricinus comm... 112 5e-23 >ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis] gi|223542494|gb|EEF44034.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 112 bits (280), Expect = 5e-23 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = +3 Query: 3 YVTSSRPRCIEEYLCTMFRLTDKEDRVGVGVYDVILKYDPGRYMLTMGRKQEPLC 167 Y+TSSRPRCIEEYLCTMFR TDKEDRV VGVY+VILKYDPGRYMLTMGRKQEPLC Sbjct: 376 YITSSRPRCIEEYLCTMFRFTDKEDRVRVGVYNVILKYDPGRYMLTMGRKQEPLC 430