BLASTX nr result
ID: Akebia24_contig00022857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00022857 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533526.1| calcium-dependent protein kinase, putative [... 89 5e-16 ref|XP_004309617.1| PREDICTED: calcium-dependent protein kinase ... 85 9e-15 emb|CBI36647.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002264388.1| PREDICTED: calcium-dependent protein kinase ... 84 2e-14 ref|XP_006494199.1| PREDICTED: calcium-dependent protein kinase ... 84 3e-14 ref|XP_006443068.1| hypothetical protein CICLE_v10024502mg [Citr... 84 3e-14 ref|XP_006664441.1| PREDICTED: calcium-dependent protein kinase ... 82 6e-14 ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase ... 82 1e-13 gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus] 81 1e-13 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 81 1e-13 ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutr... 81 1e-13 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 81 1e-13 dbj|BAK05737.1| predicted protein [Hordeum vulgare subsp. vulgare] 81 1e-13 emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana pl... 81 1e-13 gb|AHN16203.1| CPK8-2.1 [Brassica napus] 81 2e-13 gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium of... 81 2e-13 ref|XP_004960751.1| PREDICTED: calcium-dependent protein kinase ... 81 2e-13 ref|XP_004960750.1| PREDICTED: calcium-dependent protein kinase ... 81 2e-13 ref|XP_007015067.1| Calcium-dependent protein kinase 19 isoform ... 81 2e-13 ref|XP_006289217.1| hypothetical protein CARUB_v10002666mg [Caps... 81 2e-13 >ref|XP_002533526.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223526608|gb|EEF28856.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 533 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLR 158 VD DKDG+ISF+EFKAMMK+GMDW+MASRQYSRAMLN LS+KL KD S+QL+ Sbjct: 481 VDLDKDGRISFDEFKAMMKSGMDWKMASRQYSRAMLNALSMKLLKDGSMQLK 532 >ref|XP_004309617.1| PREDICTED: calcium-dependent protein kinase 24-like [Fragaria vesca subsp. vesca] Length = 528 Score = 85.1 bits (209), Expect = 9e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VD DKDG+IS+EEFKAMMK GMDW+MASRQYSRAMLN LS KL KD S+Q+ Sbjct: 477 VDLDKDGRISYEEFKAMMKTGMDWKMASRQYSRAMLNVLSRKLLKDKSIQV 527 >emb|CBI36647.3| unnamed protein product [Vitis vinifera] Length = 576 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/52 (71%), Positives = 47/52 (90%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLR 158 VD DKDG+IS++EFKAMMK GMDW+M+SRQYSRAMLN LS+++FKD S+ L+ Sbjct: 499 VDLDKDGRISYDEFKAMMKTGMDWKMSSRQYSRAMLNALSMRIFKDKSMPLQ 550 >ref|XP_002264388.1| PREDICTED: calcium-dependent protein kinase 24 [Vitis vinifera] Length = 554 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/52 (71%), Positives = 47/52 (90%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLR 158 VD DKDG+IS++EFKAMMK GMDW+M+SRQYSRAMLN LS+++FKD S+ L+ Sbjct: 477 VDLDKDGRISYDEFKAMMKTGMDWKMSSRQYSRAMLNALSMRIFKDKSMPLQ 528 >ref|XP_006494199.1| PREDICTED: calcium-dependent protein kinase 24-like [Citrus sinensis] Length = 586 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLRK 161 VD D+DG+ISFEEFKAMM +G DW+MASRQYSRAM++ LS+KLFKD S++L K Sbjct: 505 VDLDRDGRISFEEFKAMMTSGADWKMASRQYSRAMMSALSIKLFKDKSMELTK 557 >ref|XP_006443068.1| hypothetical protein CICLE_v10024502mg [Citrus clementina] gi|557545330|gb|ESR56308.1| hypothetical protein CICLE_v10024502mg [Citrus clementina] Length = 538 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLRK 161 VD D+DG+ISFEEFKAMM +G DW+MASRQYSRAM++ LS+KLFKD S++L K Sbjct: 457 VDLDRDGRISFEEFKAMMTSGADWKMASRQYSRAMMSALSIKLFKDKSMELTK 509 >ref|XP_006664441.1| PREDICTED: calcium-dependent protein kinase 32-like [Oryza brachyantha] Length = 486 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VD DKDG+IS+EEF+ MMKAGMDWR ASRQYSRA+ NTLS K+FKD SL+L Sbjct: 425 VDKDKDGKISYEEFELMMKAGMDWRNASRQYSRAVYNTLSRKMFKDVSLKL 475 >ref|XP_004250931.1| PREDICTED: calcium-dependent protein kinase 7-like [Solanum lycopersicum] Length = 533 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLRK*KG 170 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D S+Q+ K +G Sbjct: 477 VDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSIQVGKEEG 532 >gb|AGG35976.1| calcium-dependent protein kinase 7 [Brassica napus] Length = 532 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 478 VDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 528 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 477 VDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 527 >ref|XP_006399766.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|567173219|ref|XP_006399767.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100856|gb|ESQ41219.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] gi|557100857|gb|ESQ41220.1| hypothetical protein EUTSA_v10013170mg [Eutrema salsugineum] Length = 548 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 494 VDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 544 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 477 VDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 527 >dbj|BAK05737.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 559 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VD DKDG+IS+EEF+ MMKAG+DWR ASRQYSRA+ NTLS K+FKD SL+L Sbjct: 492 VDIDKDGKISYEEFELMMKAGVDWRNASRQYSRAVFNTLSRKMFKDVSLKL 542 >emb|CAG27839.1| calcium-dependent protein kinase 8 [Nicotiana plumbaginifolia] Length = 528 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 474 VDTDKDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 524 >gb|AHN16203.1| CPK8-2.1 [Brassica napus] Length = 534 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 480 VDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 530 >gb|AGI21023.1| calcium-dependent protein kinase 3 [Dendrobium officinale] Length = 536 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQLR 158 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR +LSLKL KD SLQL+ Sbjct: 481 VDTDKDGKISYEEFAAMMKAGTDWRKASRQYSRERFTSLSLKLIKDGSLQLK 532 >ref|XP_004960751.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X2 [Setaria italica] Length = 568 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VD DKDG+IS+EEF+ MMKAGMDWR SRQYSRA+ NTLS K+FKD SL+L Sbjct: 499 VDKDKDGKISYEEFELMMKAGMDWRNTSRQYSRAVYNTLSRKMFKDVSLKL 549 >ref|XP_004960750.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X1 [Setaria italica] Length = 600 Score = 80.9 bits (198), Expect = 2e-13 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VD DKDG+IS+EEF+ MMKAGMDWR SRQYSRA+ NTLS K+FKD SL+L Sbjct: 531 VDKDKDGKISYEEFELMMKAGMDWRNTSRQYSRAVYNTLSRKMFKDVSLKL 581 >ref|XP_007015067.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao] gi|508785430|gb|EOY32686.1| Calcium-dependent protein kinase 19 isoform 1 [Theobroma cacao] Length = 532 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 480 VDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 530 >ref|XP_006289217.1| hypothetical protein CARUB_v10002666mg [Capsella rubella] gi|482557923|gb|EOA22115.1| hypothetical protein CARUB_v10002666mg [Capsella rubella] Length = 534 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = +3 Query: 3 VDTDKDGQISFEEFKAMMKAGMDWRMASRQYSRAMLNTLSLKLFKDASLQL 155 VDTDKDG+IS+EEF AMMKAG DWR ASRQYSR N+LSLKL +D SLQL Sbjct: 480 VDTDKDGRISYEEFVAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQL 530