BLASTX nr result
ID: Akebia24_contig00022518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00022518 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030649.1| Cysteine synthase isoform 1 [Theobroma cacao... 87 3e-15 ref|XP_007205548.1| hypothetical protein PRUPE_ppa008600mg [Prun... 87 3e-15 ref|XP_004169252.1| PREDICTED: cysteine synthase-like, partial [... 87 3e-15 ref|XP_004139216.1| PREDICTED: cysteine synthase-like [Cucumis s... 87 3e-15 ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|3... 87 3e-15 gb|ADN33908.1| cysteine synthase [Cucumis melo subsp. melo] 87 3e-15 ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|2... 87 3e-15 gb|AFK39569.1| unknown [Medicago truncatula] 86 4e-15 ref|XP_006389317.1| O-acetylserine (thiol)lyase family protein [... 86 4e-15 gb|AAQ57205.1| O-acetylserine (thiol)lyase, partial [Populus tre... 86 4e-15 ref|XP_004506023.1| PREDICTED: l-3-cyanoalanine synthase 1, mito... 86 5e-15 ref|XP_004496722.1| PREDICTED: cysteine synthase-like [Cicer ari... 86 5e-15 ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Viti... 86 5e-15 ref|XP_004511361.1| PREDICTED: cysteine synthase-like isoform X1... 86 7e-15 ref|XP_007222677.1| hypothetical protein PRUPE_ppa008606mg [Prun... 86 7e-15 emb|CAJ32462.1| putative cytosolic cysteine synthase 7 [Nicotian... 86 7e-15 gb|AAR18402.1| cysteine synthase [Nicotiana plumbaginifolia] 86 7e-15 emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine (thiol)-lya... 86 7e-15 ref|XP_004247562.1| PREDICTED: cysteine synthase-like [Solanum l... 85 1e-14 ref|XP_002512253.1| cysteine synthase, putative [Ricinus communi... 85 1e-14 >ref|XP_007030649.1| Cysteine synthase isoform 1 [Theobroma cacao] gi|590642902|ref|XP_007030650.1| Cysteine synthase isoform 1 [Theobroma cacao] gi|508719254|gb|EOY11151.1| Cysteine synthase isoform 1 [Theobroma cacao] gi|508719255|gb|EOY11152.1| Cysteine synthase isoform 1 [Theobroma cacao] Length = 324 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAI+IAKRPENAGKLIVVVFPS GERYLSSVLFESVK+E ENM FEP Sbjct: 276 AAAAIEIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKREAENMVFEP 324 >ref|XP_007205548.1| hypothetical protein PRUPE_ppa008600mg [Prunus persica] gi|595826312|ref|XP_007205549.1| hypothetical protein PRUPE_ppa008600mg [Prunus persica] gi|452090900|gb|AGF95120.1| O-acetylserine acetyltransferase [Prunus persica] gi|462401190|gb|EMJ06747.1| hypothetical protein PRUPE_ppa008600mg [Prunus persica] gi|462401191|gb|EMJ06748.1| hypothetical protein PRUPE_ppa008600mg [Prunus persica] Length = 325 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAI+IAKRPENAGKLIVVVFPS GERYLSSVLFESVK+E ENM FEP Sbjct: 277 AAAAIEIAKRPENAGKLIVVVFPSFGERYLSSVLFESVKREAENMVFEP 325 >ref|XP_004169252.1| PREDICTED: cysteine synthase-like, partial [Cucumis sativus] Length = 103 Score = 86.7 bits (213), Expect = 3e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIV VFPS GERYLS+VLFESVK+E ENMTFEP Sbjct: 55 AAAAIKLAKRPENAGKLIVAVFPSFGERYLSTVLFESVKRETENMTFEP 103 >ref|XP_004139216.1| PREDICTED: cysteine synthase-like [Cucumis sativus] Length = 326 Score = 86.7 bits (213), Expect = 3e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIV VFPS GERYLS+VLFESVK+E ENMTFEP Sbjct: 278 AAAAIKLAKRPENAGKLIVAVFPSFGERYLSTVLFESVKRETENMTFEP 326 >ref|XP_003610724.1| Cysteine synthase [Medicago truncatula] gi|355512059|gb|AES93682.1| Cysteine synthase [Medicago truncatula] Length = 284 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV++E E MTFEP Sbjct: 236 AAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRREAETMTFEP 284 >gb|ADN33908.1| cysteine synthase [Cucumis melo subsp. melo] Length = 325 Score = 86.7 bits (213), Expect = 3e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIV VFPS GERYLS+VLFESVK+E ENMTFEP Sbjct: 277 AAAAIKLAKRPENAGKLIVAVFPSFGERYLSTVLFESVKRETENMTFEP 325 >ref|XP_003610723.1| Cysteine synthase [Medicago truncatula] gi|217074042|gb|ACJ85381.1| unknown [Medicago truncatula] gi|355512058|gb|AES93681.1| Cysteine synthase [Medicago truncatula] Length = 325 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV++E E MTFEP Sbjct: 277 AAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRREAETMTFEP 325 >gb|AFK39569.1| unknown [Medicago truncatula] Length = 325 Score = 86.3 bits (212), Expect = 4e-15 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV++E E MTFEP Sbjct: 277 AAAAIKIAKRPENAGKLIVVVFPSLGERYLSSVLFESVRREAETMTFEP 325 >ref|XP_006389317.1| O-acetylserine (thiol)lyase family protein [Populus trichocarpa] gi|566259520|ref|XP_006389318.1| hypothetical protein POPTR_0030s00390g [Populus trichocarpa] gi|118482627|gb|ABK93233.1| unknown [Populus trichocarpa] gi|550312077|gb|ERP48231.1| O-acetylserine (thiol)lyase family protein [Populus trichocarpa] gi|550312078|gb|ERP48232.1| hypothetical protein POPTR_0030s00390g [Populus trichocarpa] Length = 325 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIV +FPS GERYLSSVLFESVK+E ENM FEP Sbjct: 277 AAAAIKIAKRPENAGKLIVAIFPSFGERYLSSVLFESVKKEAENMVFEP 325 >gb|AAQ57205.1| O-acetylserine (thiol)lyase, partial [Populus tremula x Populus alba] Length = 292 Score = 86.3 bits (212), Expect = 4e-15 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIV +FPS GERYLSSVLFESVK+E ENM FEP Sbjct: 244 AAAAIKIAKRPENAGKLIVAIFPSFGERYLSSVLFESVKKEAENMVFEP 292 >ref|XP_004506023.1| PREDICTED: l-3-cyanoalanine synthase 1, mitochondrial-like [Cicer arietinum] Length = 337 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV+Q+ E++TFEP Sbjct: 289 AAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRQKAESLTFEP 337 >ref|XP_004496722.1| PREDICTED: cysteine synthase-like [Cicer arietinum] Length = 325 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV+Q+ E++TFEP Sbjct: 277 AAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRQKAESLTFEP 325 >ref|XP_002275990.1| PREDICTED: cysteine synthase isoform 2 [Vitis vinifera] gi|225451237|ref|XP_002275940.1| PREDICTED: cysteine synthase isoform 1 [Vitis vinifera] gi|359487829|ref|XP_003633658.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|147819267|emb|CAN75607.1| hypothetical protein VITISV_033255 [Vitis vinifera] gi|298204909|emb|CBI34216.3| unnamed protein product [Vitis vinifera] Length = 325 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIVVVFPS GERYLSSVLF+SVK+E ENM FEP Sbjct: 277 AAAAIKLAKRPENAGKLIVVVFPSFGERYLSSVLFDSVKREAENMLFEP 325 >ref|XP_004511361.1| PREDICTED: cysteine synthase-like isoform X1 [Cicer arietinum] gi|502159006|ref|XP_004511362.1| PREDICTED: cysteine synthase-like isoform X2 [Cicer arietinum] Length = 325 Score = 85.5 bits (210), Expect = 7e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV+++ E MTFEP Sbjct: 277 AAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRRQAETMTFEP 325 >ref|XP_007222677.1| hypothetical protein PRUPE_ppa008606mg [Prunus persica] gi|462419613|gb|EMJ23876.1| hypothetical protein PRUPE_ppa008606mg [Prunus persica] Length = 325 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAI+IAKRPENAGKLIVV+FPS GERYLSSVLFESV++E E+MTFEP Sbjct: 277 AAAAIRIAKRPENAGKLIVVIFPSFGERYLSSVLFESVRREAESMTFEP 325 >emb|CAJ32462.1| putative cytosolic cysteine synthase 7 [Nicotiana tabacum] gi|530704739|gb|AGT40334.1| O-acetylserine thiol-lyase [Nicotiana attenuata] Length = 325 Score = 85.5 bits (210), Expect = 7e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIVVVFPS GERYLSSVLFESV++E ENMT EP Sbjct: 277 AAAAIKLAKRPENAGKLIVVVFPSFGERYLSSVLFESVRREAENMTVEP 325 >gb|AAR18402.1| cysteine synthase [Nicotiana plumbaginifolia] Length = 323 Score = 85.5 bits (210), Expect = 7e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIVVVFPS GERYLSSVLFESV++E ENMT EP Sbjct: 275 AAAAIKLAKRPENAGKLIVVVFPSFGERYLSSVLFESVRREAENMTVEP 323 >emb|CAA06819.1| cysteine synthase, O-acetyl-L-serine (thiol)-lyase [Cicer arietinum] Length = 266 Score = 85.5 bits (210), Expect = 7e-15 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIAKRPENAGKLIVVVFPS GERYLSSVLFESV+++ E MTFEP Sbjct: 218 AAAAIKIAKRPENAGKLIVVVFPSFGERYLSSVLFESVRRQAETMTFEP 266 >ref|XP_004247562.1| PREDICTED: cysteine synthase-like [Solanum lycopersicum] Length = 325 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIK+AKRPENAGKLIVVVFPS GERYLSSVLFE+V++E ENMT EP Sbjct: 277 AAAAIKVAKRPENAGKLIVVVFPSFGERYLSSVLFETVRREAENMTVEP 325 >ref|XP_002512253.1| cysteine synthase, putative [Ricinus communis] gi|223548214|gb|EEF49705.1| cysteine synthase, putative [Ricinus communis] Length = 325 Score = 84.7 bits (208), Expect = 1e-14 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +3 Query: 3 AAAAIKIAKRPENAGKLIVVVFPSGGERYLSSVLFESVKQEVENMTFEP 149 AAAAIKIA+RPENAGKLIVV+FPS GERYLSSVLFESVK+E E+M FEP Sbjct: 277 AAAAIKIARRPENAGKLIVVIFPSFGERYLSSVLFESVKREAESMVFEP 325