BLASTX nr result
ID: Akebia24_contig00021813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00021813 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038868.1| Late embryogenesis abundant hydroxyproline-r... 55 1e-05 ref|XP_007022216.1| Late embryogenesis abundant hydroxyproline-r... 55 1e-05 >ref|XP_007038868.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, putative [Theobroma cacao] gi|508776113|gb|EOY23369.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, putative [Theobroma cacao] Length = 201 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/69 (42%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Frame = +1 Query: 145 YGSIFVVFQVIXXXXXXXXXXRVQSPKVRIETITFIDQKITTSP--ASFAIKLLAEVTIK 318 Y + FVVFQ I R+++PK R+ +IT D T++P SF +K AEV +K Sbjct: 30 YAAAFVVFQTIVILVFSLTVMRIKNPKFRVRSITVEDIAYTSTPNPPSFNMKFNAEVAVK 89 Query: 319 NRNFGEYKF 345 N NFG +KF Sbjct: 90 NTNFGHFKF 98 >ref|XP_007022216.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, putative [Theobroma cacao] gi|508721844|gb|EOY13741.1| Late embryogenesis abundant hydroxyproline-rich glycofamily protein, putative [Theobroma cacao] Length = 259 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/67 (38%), Positives = 37/67 (55%) Frame = +1 Query: 145 YGSIFVVFQVIXXXXXXXXXXRVQSPKVRIETITFIDQKITTSPASFAIKLLAEVTIKNR 324 Y + FV+FQ R+++PK RI ++ D S SF +K +A+VT+KN Sbjct: 27 YVAAFVIFQTAIILVFALTVMRIKNPKFRIRSVLVDDLTFNNSSPSFNMKFIAQVTVKNT 86 Query: 325 NFGEYKF 345 NFG YKF Sbjct: 87 NFGHYKF 93