BLASTX nr result
ID: Akebia24_contig00021368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00021368 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20032.1| Protein UXT-like protein [Morus notabilis] 62 1e-07 ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citr... 56 4e-06 >gb|EXC20032.1| Protein UXT-like protein [Morus notabilis] Length = 265 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 187 TEMDIFRQEKIQRFEDFVDRRLKPDLVRAIAER 285 TEMD +RQEKIQ+FE+FVDRRLKPDL+RAIAER Sbjct: 75 TEMDSYRQEKIQKFEEFVDRRLKPDLIRAIAER 107 >ref|XP_006438761.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|567892483|ref|XP_006438762.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|568859128|ref|XP_006483094.1| PREDICTED: protein UXT homolog isoform X1 [Citrus sinensis] gi|568859130|ref|XP_006483095.1| PREDICTED: protein UXT homolog isoform X2 [Citrus sinensis] gi|557540957|gb|ESR52001.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] gi|557540958|gb|ESR52002.1| hypothetical protein CICLE_v10032989mg [Citrus clementina] Length = 151 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 193 MDIFRQEKIQRFEDFVDRRLKPDLVRAIAER 285 MD +RQEK+Q+FE+FVDRRLKPDL RAIAER Sbjct: 1 MDSYRQEKVQKFEEFVDRRLKPDLTRAIAER 31