BLASTX nr result
ID: Akebia24_contig00020999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00020999 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31178.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_006484767.1| PREDICTED: microtubule-associated protein fu... 59 7e-07 ref|XP_006437312.1| hypothetical protein CICLE_v10030490mg [Citr... 59 7e-07 ref|XP_006437311.1| hypothetical protein CICLE_v10030490mg [Citr... 59 7e-07 ref|XP_002530965.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >emb|CBI31178.3| unnamed protein product [Vitis vinifera] Length = 1205 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/42 (52%), Positives = 32/42 (76%) Frame = -2 Query: 128 MGVDAMEIGVYMRKGLIFTIRTCYKSACNHPFVMGLVLFFFF 3 MG D ++IG+ +++GLIF+ R CY+S CNHPF++G V F F Sbjct: 1 MGFDGLKIGIQIKRGLIFSTRICYRSVCNHPFLVGFVFFLIF 42 >ref|XP_006484767.1| PREDICTED: microtubule-associated protein futsch-like [Citrus sinensis] Length = 1620 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 128 MGVDAMEIGVYMRKGLIFTIRTCYKSACNHPFVMGLVLFFFF 3 MGVDAM IGV MRK + F++RTCY CNHPF++G + F F Sbjct: 1 MGVDAMRIGVQMRKVMSFSMRTCYGLVCNHPFLVGFMCFLIF 42 >ref|XP_006437312.1| hypothetical protein CICLE_v10030490mg [Citrus clementina] gi|557539508|gb|ESR50552.1| hypothetical protein CICLE_v10030490mg [Citrus clementina] Length = 1286 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 128 MGVDAMEIGVYMRKGLIFTIRTCYKSACNHPFVMGLVLFFFF 3 MGVDAM IGV MRK + F++RTCY CNHPF++G + F F Sbjct: 1 MGVDAMRIGVQMRKVMSFSMRTCYGLVCNHPFLVGFMCFLIF 42 >ref|XP_006437311.1| hypothetical protein CICLE_v10030490mg [Citrus clementina] gi|557539507|gb|ESR50551.1| hypothetical protein CICLE_v10030490mg [Citrus clementina] Length = 1661 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 128 MGVDAMEIGVYMRKGLIFTIRTCYKSACNHPFVMGLVLFFFF 3 MGVDAM IGV MRK + F++RTCY CNHPF++G + F F Sbjct: 1 MGVDAMRIGVQMRKVMSFSMRTCYGLVCNHPFLVGFMCFLIF 42 >ref|XP_002530965.1| conserved hypothetical protein [Ricinus communis] gi|223529480|gb|EEF31437.1| conserved hypothetical protein [Ricinus communis] Length = 1204 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = -2 Query: 128 MGVDAMEIGVYMRKGLIFTIRTCYKSACNHPFVMGLVLFFFF 3 MG+DAM I V +++ L+ +IRTCYKS C HPF++G V F F Sbjct: 1 MGLDAMRIRVEIKRFLVISIRTCYKSVCKHPFLVGFVCFLIF 42