BLASTX nr result
ID: Akebia24_contig00020884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00020884 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319994.2| hypothetical protein POPTR_0014s011202g, par... 59 7e-07 >ref|XP_002319994.2| hypothetical protein POPTR_0014s011202g, partial [Populus trichocarpa] gi|550323079|gb|EEE98309.2| hypothetical protein POPTR_0014s011202g, partial [Populus trichocarpa] Length = 1030 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = +2 Query: 2 FPQLKELRLWDMDELEEWDL-RVEDGVIMPCLRKLSLQNFPKLQVLPALGNLPVLESLWI 178 FP LKEL L MD LEEW + VE + PCL +LS++ KL+ LP LG LP L+ L + Sbjct: 536 FPALKELTLSSMDGLEEWMVPGVEGYQVFPCLEELSIRQCGKLRQLPTLGCLPRLKILEM 595 Query: 179 EEMNSVK 199 EM +VK Sbjct: 596 SEMGTVK 602