BLASTX nr result
ID: Akebia24_contig00020858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00020858 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65989.1| hypothetical protein VITISV_042146 [Vitis vinifera] 72 1e-15 >emb|CAN65989.1| hypothetical protein VITISV_042146 [Vitis vinifera] Length = 250 Score = 72.0 bits (175), Expect(3) = 1e-15 Identities = 36/44 (81%), Positives = 37/44 (84%), Gaps = 4/44 (9%) Frame = -1 Query: 122 ATYTTDE*TFAALGRQR----WQGRAFLCRDPHVQLLIRTYPPD 3 AT TTDE TFAALGR + WQGRAFLCRDPHVQLLIRTYPPD Sbjct: 190 ATTTTDECTFAALGRFQGEWGWQGRAFLCRDPHVQLLIRTYPPD 233 Score = 32.0 bits (71), Expect(3) = 1e-15 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 316 DMARPLLIS*VLSRLDLSNTVESGLAV 236 + ARPLLIS VLSRLDLSN L V Sbjct: 146 NQARPLLISLVLSRLDLSNLFYLSLEV 172 Score = 24.3 bits (51), Expect(3) = 1e-15 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -3 Query: 153 KFWFEQIPF 127 +FWFEQIPF Sbjct: 176 QFWFEQIPF 184