BLASTX nr result
ID: Akebia24_contig00020706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00020706 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270174.1| PREDICTED: putative phosphatidylglycerol/pho... 61 2e-07 emb|CAN64691.1| hypothetical protein VITISV_030670 [Vitis vinifera] 61 2e-07 ref|XP_007028019.1| MD-2-related lipid recognition domain-contai... 57 2e-06 gb|EPS60934.1| hypothetical protein M569_13865, partial [Genlise... 57 3e-06 ref|XP_006348569.1| PREDICTED: phosphatidylglycerol/phosphatidyl... 56 4e-06 ref|XP_004228716.1| PREDICTED: phosphatidylglycerol/phosphatidyl... 56 4e-06 gb|ACM47316.1| putative ML domain protein [Capsicum annuum] 56 4e-06 ref|NP_001236775.1| uncharacterized protein LOC100306050 precurs... 55 8e-06 gb|ACG38215.1| ML domain protein [Zea mays] 55 8e-06 ref|NP_001131910.1| ML domain protein precursor [Zea mays] gi|19... 55 8e-06 ref|XP_002271535.1| PREDICTED: putative phosphatidylglycerol/pho... 55 8e-06 ref|XP_006826438.1| hypothetical protein AMTR_s00004p00170000 [A... 55 1e-05 dbj|BAJ94095.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 1e-05 ref|XP_002524079.1| Phosphatidylglycerol/phosphatidylinositol tr... 55 1e-05 >ref|XP_002270174.1| PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Vitis vinifera] gi|296084851|emb|CBI28260.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYTLKMKM E HQLTCI F+FNI Sbjct: 113 LPGFTPPGSYTLKMKMEDESKHQLTCITFNFNI 145 >emb|CAN64691.1| hypothetical protein VITISV_030670 [Vitis vinifera] Length = 154 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYTLKMKM E HQLTCI F+FNI Sbjct: 113 LPGFTPPGSYTLKMKMEDESKHQLTCITFNFNI 145 >ref|XP_007028019.1| MD-2-related lipid recognition domain-containing protein / ML domain-containing protein [Theobroma cacao] gi|508716624|gb|EOY08521.1| MD-2-related lipid recognition domain-containing protein / ML domain-containing protein [Theobroma cacao] Length = 156 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSY+LKM+M K H+LTCI FDF+I Sbjct: 115 LPGFTPPGSYSLKMRMYDAKKHELTCIGFDFDI 147 >gb|EPS60934.1| hypothetical protein M569_13865, partial [Genlisea aurea] Length = 91 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPG TPPG+Y LKMKM+ EK+ QLTCI FDF+I Sbjct: 52 LPGITPPGNYNLKMKMVDEKNKQLTCITFDFSI 84 >ref|XP_006348569.1| PREDICTED: phosphatidylglycerol/phosphatidylinositol transfer protein-like [Solanum tuberosum] Length = 193 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYTL MKM+ EK+ QL+CI F F+I Sbjct: 148 LPGFTPPGSYTLTMKMVDEKNKQLSCITFSFSI 180 >ref|XP_004228716.1| PREDICTED: phosphatidylglycerol/phosphatidylinositol transfer protein-like isoform 1 [Solanum lycopersicum] Length = 195 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYTL MKM+ EK+ QL+CI F F+I Sbjct: 150 LPGFTPPGSYTLTMKMVDEKNKQLSCITFSFSI 182 >gb|ACM47316.1| putative ML domain protein [Capsicum annuum] Length = 157 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYTL MKM+ EK+ QL+CI+F F+I Sbjct: 112 LPGFTPPGSYTLTMKMMDEKNEQLSCISFSFSI 144 >ref|NP_001236775.1| uncharacterized protein LOC100306050 precursor [Glycine max] gi|255627393|gb|ACU14041.1| unknown [Glycine max] Length = 154 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYTLKMKM H+LTCI F F+I Sbjct: 113 LPGFTPPGSYTLKMKMFDGNKHELTCITFGFDI 145 >gb|ACG38215.1| ML domain protein [Zea mays] Length = 154 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYT+ MKM+G+ D +L+CI+F F+I Sbjct: 116 LPGFTPPGSYTIYMKMVGDDDEELSCISFGFSI 148 >ref|NP_001131910.1| ML domain protein precursor [Zea mays] gi|194692896|gb|ACF80532.1| unknown [Zea mays] gi|414883580|tpg|DAA59594.1| TPA: ML domain protein [Zea mays] Length = 151 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSYT+ MKM+G+ D +L+CI+F F+I Sbjct: 113 LPGFTPPGSYTIYMKMVGDDDEELSCISFGFSI 145 >ref|XP_002271535.1| PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 isoform 1 [Vitis vinifera] gi|147819263|emb|CAN73359.1| hypothetical protein VITISV_026937 [Vitis vinifera] gi|296089354|emb|CBI39126.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPG+Y LKMK++ +K+ +LTCI FDF+I Sbjct: 113 LPGFTPPGTYNLKMKLVDKKNKELTCIGFDFSI 145 >ref|XP_006826438.1| hypothetical protein AMTR_s00004p00170000 [Amborella trichopoda] gi|548830752|gb|ERM93675.1| hypothetical protein AMTR_s00004p00170000 [Amborella trichopoda] Length = 152 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LP +TPPGSYTLKMKM+G QLTCINF F+I Sbjct: 111 LPTYTPPGSYTLKMKMLGSDGKQLTCINFGFSI 143 >dbj|BAJ94095.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 154 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LP FTPPGSY+L+MK++G+K +LTCI+F FNI Sbjct: 113 LPSFTPPGSYSLQMKLLGDKKEELTCISFGFNI 145 >ref|XP_002524079.1| Phosphatidylglycerol/phosphatidylinositol transfer protein precursor, putative [Ricinus communis] gi|223536647|gb|EEF38289.1| Phosphatidylglycerol/phosphatidylinositol transfer protein precursor, putative [Ricinus communis] Length = 155 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 377 LPGFTPPGSYTLKMKMIGEKDHQLTCINFDFNI 279 LPGFTPPGSY+L MKM K H+LTCI FDF+I Sbjct: 114 LPGFTPPGSYSLTMKMYDGKKHELTCIAFDFSI 146