BLASTX nr result
ID: Akebia24_contig00020628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00020628 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009308.1| SC35-like splicing factor 30 isoform 1 [Theo... 55 1e-05 >ref|XP_007009308.1| SC35-like splicing factor 30 isoform 1 [Theobroma cacao] gi|590563224|ref|XP_007009309.1| SC35-like splicing factor 30 isoform 1 [Theobroma cacao] gi|508726221|gb|EOY18118.1| SC35-like splicing factor 30 isoform 1 [Theobroma cacao] gi|508726222|gb|EOY18119.1| SC35-like splicing factor 30 isoform 1 [Theobroma cacao] Length = 271 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/40 (72%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = +2 Query: 2 KPTYESEKERRDWRSP-GLASRLPSGSRSRSADLSPRHSR 118 K YESE+ R WRSP G SR PSGSRSRSADLSPR SR Sbjct: 232 KSAYESEEARAAWRSPPGRVSRSPSGSRSRSADLSPRRSR 271