BLASTX nr result
ID: Akebia24_contig00019796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019796 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513240.1| nucleic acid binding protein, putative [Rici... 60 2e-07 >ref|XP_002513240.1| nucleic acid binding protein, putative [Ricinus communis] gi|223547614|gb|EEF49108.1| nucleic acid binding protein, putative [Ricinus communis] Length = 119 Score = 60.5 bits (145), Expect = 2e-07 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 5/98 (5%) Frame = -1 Query: 313 GCSKIQIQSDSLQAIQVLKG-----RWNPLWTVLHIVLNIRNLLHRLSEVSFFHVFREVN 149 G K++++ DSL +Q+LKG +N L ++ NIR L+R EVS H++RE N Sbjct: 27 GVLKLKVEIDSLYVVQLLKGIKVVCNYNGL-----LISNIRQYLNREWEVSIVHIYRESN 81 Query: 148 KAADMLASYQNNFGCTELDCGLLSSDLVSVIYQDACGI 35 AAD LA NF + G S+DL+ ++Y D G+ Sbjct: 82 FAADALAFLAANFPLGYHELGAASNDLLDMLYHDIEGV 119