BLASTX nr result
ID: Akebia24_contig00019415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019415 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532630.1| transcription factor, putative [Ricinus comm... 59 9e-07 ref|XP_006586580.1| PREDICTED: B3 domain-containing protein At2g... 57 2e-06 ref|XP_006385973.1| hypothetical protein POPTR_0003s19090g [Popu... 57 2e-06 ref|XP_002532629.1| transcription factor, putative [Ricinus comm... 57 3e-06 ref|XP_006586578.1| PREDICTED: B3 domain-containing protein At2g... 57 4e-06 ref|XP_006490696.1| PREDICTED: B3 domain-containing protein At2g... 55 8e-06 ref|XP_006490479.1| PREDICTED: B3 domain-containing protein At2g... 55 8e-06 ref|XP_006421994.1| hypothetical protein CICLE_v10006908mg [Citr... 55 8e-06 ref|XP_006421992.1| hypothetical protein CICLE_v10006773mg [Citr... 55 8e-06 ref|XP_006421972.1| hypothetical protein CICLE_v10006716mg [Citr... 55 8e-06 >ref|XP_002532630.1| transcription factor, putative [Ricinus communis] gi|223527650|gb|EEF29761.1| transcription factor, putative [Ricinus communis] Length = 251 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V++WD+DT +EH LT K S S VF D W VKRR+LK GDEI + WD Sbjct: 185 VILWDIDTATEHKLTLKKWISCGSFVFNDGWTQNFVKRRNLKKGDEIGIVWD 236 >ref|XP_006586580.1| PREDICTED: B3 domain-containing protein At2g33720-like [Glycine max] Length = 156 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/52 (51%), Positives = 33/52 (63%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 + +WD+DT S H L FK S+ S VFIDNWN V RR+L DEI + WD Sbjct: 88 ITIWDVDTQSMHYLVFKFWASSRSYVFIDNWNKDFVNRRNLHIKDEIGLHWD 139 >ref|XP_006385973.1| hypothetical protein POPTR_0003s19090g [Populus trichocarpa] gi|550343518|gb|ERP63770.1| hypothetical protein POPTR_0003s19090g [Populus trichocarpa] Length = 269 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/56 (50%), Positives = 35/56 (62%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWDRDQS 169 V VWD+DT S H L FK ++ S +F D W VKRR+L+ DEI + WD DQS Sbjct: 196 VWVWDIDTGSMHQLVFKRWSTSKSYIFNDGWTKHFVKRRNLRESDEIGLYWDNDQS 251 >ref|XP_002532629.1| transcription factor, putative [Ricinus communis] gi|223527649|gb|EEF29760.1| transcription factor, putative [Ricinus communis] Length = 261 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V+ WD+DT +EH LT K S S +F D W + VKRR+LK GDEI + WD Sbjct: 195 VIFWDVDTATEHKLTLKKWISCESYMFKDGWTQEFVKRRNLKKGDEIGIFWD 246 >ref|XP_006586578.1| PREDICTED: B3 domain-containing protein At2g33720-like [Glycine max] Length = 156 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 + +WD+DT S H L FK S+ S VFIDNWN V RR L DEI + WD Sbjct: 88 ITIWDVDTQSMHYLVFKFWASSRSYVFIDNWNKDFVNRRSLHIKDEIGLHWD 139 >ref|XP_006490696.1| PREDICTED: B3 domain-containing protein At2g33720-like [Citrus sinensis] Length = 315 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V VWD DT S H L FK ++ S V I++W V+RR L GDEI MCWD Sbjct: 234 VSVWDCDTNSMHRLVFKKWATSNSYVLINHWTADFVRRRELAAGDEIGMCWD 285 >ref|XP_006490479.1| PREDICTED: B3 domain-containing protein At2g33720-like [Citrus sinensis] Length = 298 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V VWD DT S H L FK ++ S V I++W V+RR L GDEI MCWD Sbjct: 217 VSVWDCDTNSMHRLVFKKWATSNSYVLINHWTADFVRRRELAAGDEIGMCWD 268 >ref|XP_006421994.1| hypothetical protein CICLE_v10006908mg [Citrus clementina] gi|557523867|gb|ESR35234.1| hypothetical protein CICLE_v10006908mg [Citrus clementina] Length = 315 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V VWD DT S H L FK ++ S V I++W V+RR L GDEI MCWD Sbjct: 234 VSVWDCDTNSMHRLVFKKWATSNSYVLINHWTADFVRRRELAAGDEIGMCWD 285 >ref|XP_006421992.1| hypothetical protein CICLE_v10006773mg [Citrus clementina] gi|557523865|gb|ESR35232.1| hypothetical protein CICLE_v10006773mg [Citrus clementina] Length = 298 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V VWD DT S H L FK ++ S V I++W V+RR L GDEI MCWD Sbjct: 215 VSVWDCDTNSMHRLVFKKWATSNSYVLINHWTADFVRRRELAAGDEIGMCWD 266 >ref|XP_006421972.1| hypothetical protein CICLE_v10006716mg [Citrus clementina] gi|557523845|gb|ESR35212.1| hypothetical protein CICLE_v10006716mg [Citrus clementina] Length = 288 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/52 (51%), Positives = 32/52 (61%) Frame = +2 Query: 2 VVVWDLDTLSEH*LTFKMVRSTTS*VFIDNWNDQIVKRRHLK*GDEIRMCWD 157 V VWD DT S H L FK ++ S V I++W V+RR L GDEI MCWD Sbjct: 207 VSVWDCDTNSMHRLVFKKWATSNSYVLINHWTADFVRRRELAAGDEIGMCWD 258