BLASTX nr result
ID: Akebia24_contig00019344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019344 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025876.1| S-locus lectin protein kinase family protein... 55 8e-06 >ref|XP_007025876.1| S-locus lectin protein kinase family protein [Theobroma cacao] gi|508781242|gb|EOY28498.1| S-locus lectin protein kinase family protein [Theobroma cacao] Length = 818 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/51 (54%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -2 Query: 364 VLMLGSETSILPQPKQPGFYNERSFIEADPSSSSGIQC-TTEVTVSWSVGR 215 +LML SE LPQPKQPGFY ER F E D SS+ + C + E+T+S GR Sbjct: 768 LLMLDSENPSLPQPKQPGFYTERFFTETDTSSTGKMPCNSNEITISMLQGR 818