BLASTX nr result
ID: Akebia24_contig00019094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00019094 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] 60 2e-09 ref|XP_007027153.1| RNA-binding family protein with retrovirus z... 63 5e-08 ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prun... 63 5e-08 >gb|EMS67637.1| Neurofilament heavy polypeptide [Triticum urartu] Length = 431 Score = 59.7 bits (143), Expect(2) = 2e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 136 LRGEVSYPSFLSHDGLTVSGNRFRRVRDVDLKHDFAFIEFNDPRD 2 LRG+ +L DG+TVSGN F RVR VD+KH+FAF+EF+DPRD Sbjct: 115 LRGDTFL--YLRLDGVTVSGNHFHRVRHVDMKHEFAFVEFSDPRD 157 Score = 28.1 bits (61), Expect(2) = 2e-09 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 270 W*EGALGGFGGYS 232 W EGALGG GGYS Sbjct: 98 WWEGALGGIGGYS 110 >ref|XP_007027153.1| RNA-binding family protein with retrovirus zinc finger-like domain, putative [Theobroma cacao] gi|508715758|gb|EOY07655.1| RNA-binding family protein with retrovirus zinc finger-like domain, putative [Theobroma cacao] Length = 312 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 127 EVSYPSFLSHDGLTVSGNRFRRVRDVDLKHDFAFIEFNDPRD 2 E+ +LS+DGLTVS N FRR+RDVD+KHDFAF+E + PRD Sbjct: 58 EIPAQCYLSNDGLTVSSNNFRRIRDVDMKHDFAFVELSYPRD 99 >ref|XP_007205642.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica] gi|462401284|gb|EMJ06841.1| hypothetical protein PRUPE_ppa009294mg [Prunus persica] Length = 282 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -2 Query: 109 FLSHDGLTVSGNRFRRVRDVDLKHDFAFIEFNDPRD 2 +LS+D LTVSGNR RRVRDVD+K +FAF+EF+DPRD Sbjct: 5 YLSNDSLTVSGNRLRRVRDVDMKREFAFVEFSDPRD 40