BLASTX nr result
ID: Akebia24_contig00018340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018340 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36966.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|XP_007221553.1| hypothetical protein PRUPE_ppa001263mg [Prun... 88 1e-15 ref|XP_007051141.1| S uncoupled 1 [Theobroma cacao] gi|508703402... 87 2e-15 ref|XP_002320970.2| hypothetical protein POPTR_0014s11380g [Popu... 87 2e-15 ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Popu... 84 3e-14 ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Popu... 84 3e-14 ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containi... 83 5e-14 gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus... 81 1e-13 ref|XP_006841446.1| hypothetical protein AMTR_s00003p00075520 [A... 81 1e-13 ref|XP_006355855.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_004240564.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_002515260.1| pentatricopeptide repeat-containing protein,... 80 2e-13 ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citr... 80 4e-13 ref|XP_004288538.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_006417966.1| hypothetical protein EUTSA_v10006755mg [Eutr... 75 7e-12 ref|XP_004240565.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_006293642.1| hypothetical protein CARUB_v10022597mg [Caps... 71 2e-10 >emb|CBI36966.3| unnamed protein product [Vitis vinifera] Length = 730 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/59 (79%), Positives = 50/59 (84%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAKCN+GRFISTGAVVAAWLRESGTLKVL+LHD RTNP + SQ NLQ LPL Sbjct: 672 GAPFRVAKCNLGRFISTGAVVAAWLRESGTLKVLVLHDDRTNPDRARCSQISNLQTLPL 730 >ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Vitis vinifera] Length = 867 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/59 (79%), Positives = 50/59 (84%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAKCN+GRFISTGAVVAAWLRESGTLKVL+LHD RTNP + SQ NLQ LPL Sbjct: 809 GAPFRVAKCNLGRFISTGAVVAAWLRESGTLKVLVLHDDRTNPDRARCSQISNLQTLPL 867 >ref|XP_007221553.1| hypothetical protein PRUPE_ppa001263mg [Prunus persica] gi|462418303|gb|EMJ22752.1| hypothetical protein PRUPE_ppa001263mg [Prunus persica] Length = 868 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/59 (69%), Positives = 48/59 (81%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAKCN+GRFISTG++ AAWLRESGTL+VL+LHD RT P++ L Q NLQ L L Sbjct: 810 GAPFRVAKCNLGRFISTGSMAAAWLRESGTLEVLVLHDDRTCPKSADLEQTSNLQALAL 868 >ref|XP_007051141.1| S uncoupled 1 [Theobroma cacao] gi|508703402|gb|EOX95298.1| S uncoupled 1 [Theobroma cacao] Length = 866 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF +AKCN+GRF+STG VV AWLRESGTLK+L+LHD RT P+ T Q NLQ L L Sbjct: 808 GAPFRLAKCNLGRFVSTGPVVTAWLRESGTLKLLVLHDDRTQPENTGFGQISNLQTLTL 866 >ref|XP_002320970.2| hypothetical protein POPTR_0014s11380g [Populus trichocarpa] gi|550323986|gb|EEE99285.2| hypothetical protein POPTR_0014s11380g [Populus trichocarpa] Length = 875 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/59 (69%), Positives = 47/59 (79%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF +AKCN+GRFISTG+VVAAWLRESGTLKVL+LHD RT + + Q NLQ L L Sbjct: 817 GAPFRLAKCNLGRFISTGSVVAAWLRESGTLKVLVLHDHRTEQENLRFGQASNLQTLQL 875 >ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Cucumis sativus] Length = 868 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAKCNIGR++STG+VVAAWL+ESGTLK+L+LHD RT+P T + LQ + L Sbjct: 810 GAPFRVAKCNIGRYVSTGSVVAAWLKESGTLKLLVLHDDRTHPDTENMDLISKLQTISL 868 >ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] gi|550345388|gb|ERP64510.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] Length = 873 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF AKCN+GR ISTG+VVA+WLRESGTLKVL+LHD RT+ + + Q NLQ+L L Sbjct: 815 GAPFRSAKCNLGRLISTGSVVASWLRESGTLKVLVLHDDRTHQENLRFGQISNLQMLQL 873 >ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] gi|550345387|gb|EEE80792.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] Length = 864 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/59 (66%), Positives = 47/59 (79%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF AKCN+GR ISTG+VVA+WLRESGTLKVL+LHD RT+ + + Q NLQ+L L Sbjct: 806 GAPFRSAKCNLGRLISTGSVVASWLRESGTLKVLVLHDDRTHQENLRFGQISNLQMLQL 864 >ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Cucumis sativus] Length = 868 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAKCNIGR++STG+VVAAWL+ESGTLK+L+LHD RT+P + + LQ + L Sbjct: 810 GAPFRVAKCNIGRYVSTGSVVAAWLKESGTLKLLVLHDDRTHPDSENMDLISKLQTISL 868 >gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus guttatus] Length = 843 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 5/64 (7%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQT-----TQLSQHPNLQ 167 GAPF +AKCNIGRFISTG+VV AWLRESG+LKVL+L D RT+ T T+ + PN Q Sbjct: 780 GAPFKIAKCNIGRFISTGSVVTAWLRESGSLKVLVLQDDRTHTGTISSSSTRFDRIPNFQ 839 Query: 168 ILPL 179 LPL Sbjct: 840 PLPL 843 >ref|XP_006841446.1| hypothetical protein AMTR_s00003p00075520 [Amborella trichopoda] gi|548843467|gb|ERN03121.1| hypothetical protein AMTR_s00003p00075520 [Amborella trichopoda] Length = 857 Score = 81.3 bits (199), Expect = 1e-13 Identities = 41/59 (69%), Positives = 48/59 (81%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAK N+GRFISTGAVV AWL+ES TLK+LILHD RT+P+ +L Q NLQ+L L Sbjct: 800 GAPFEVAKFNVGRFISTGAVVGAWLKESRTLKLLILHDERTDPE-ARLDQLSNLQVLTL 857 >ref|XP_006355855.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Solanum tuberosum] Length = 848 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VAKCNIGRFISTGAVV AWLRESGTL+VL+L D ++ + T+ Q NLQ L L Sbjct: 790 GAPFQVAKCNIGRFISTGAVVTAWLRESGTLEVLVLQDDTSHLRATRFGQISNLQQLTL 848 >ref|XP_004240564.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 841 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/59 (66%), Positives = 46/59 (77%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF +AKCNIGRFISTGAVV AWLRESGTL+VL+L D ++ + T+ Q NLQ L L Sbjct: 783 GAPFQIAKCNIGRFISTGAVVTAWLRESGTLEVLVLQDDTSHLRATRFDQISNLQQLTL 841 >ref|XP_002515260.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545740|gb|EEF47244.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 878 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQL 146 GAPF +AKCN+GRFISTG+VVAAWL+ESGTL+VL+LHD RT+P+ L Sbjct: 812 GAPFRLAKCNLGRFISTGSVVAAWLKESGTLEVLVLHDDRTHPENKDL 859 >ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Citrus sinensis] Length = 877 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VA CN+GRFISTG +VA+WLRESGTLKVL+LHD RT+ + + N+Q L L Sbjct: 819 GAPFWVANCNLGRFISTGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQTLTL 877 >ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citrus clementina] gi|557546795|gb|ESR57773.1| hypothetical protein CICLE_v10018807mg [Citrus clementina] Length = 877 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF VA CN+GRFISTG +VA+WLRESGTLKVL+LHD RT+ + + N+Q L L Sbjct: 819 GAPFWVANCNLGRFISTGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQTLTL 877 >ref|XP_004288538.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 870 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/59 (61%), Positives = 44/59 (74%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQILPL 179 GAPF V +CNIGRFISTG+V AAWL+ESGTL+VL+LHD R P + Q +L+ L L Sbjct: 812 GAPFRVHECNIGRFISTGSVAAAWLKESGTLEVLMLHDDRAEPNSANFGQISDLRALAL 870 >ref|XP_006417966.1| hypothetical protein EUTSA_v10006755mg [Eutrema salsugineum] gi|557095737|gb|ESQ36319.1| hypothetical protein EUTSA_v10006755mg [Eutrema salsugineum] Length = 895 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLS 149 GAPFHVAKCN+GRF+S+G+VVAAWLRESGTLKVL+L D + + LS Sbjct: 846 GAPFHVAKCNVGRFVSSGSVVAAWLRESGTLKVLVLEDHKHEEASLPLS 894 >ref|XP_004240565.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 829 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +3 Query: 3 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQ 143 GAPF +AKCNIGRFISTGAVV AWLRESGTL+VL+L D ++ + T+ Sbjct: 783 GAPFQIAKCNIGRFISTGAVVTAWLRESGTLEVLVLQDDTSHLRATR 829 >ref|XP_006293642.1| hypothetical protein CARUB_v10022597mg [Capsella rubella] gi|482562350|gb|EOA26540.1| hypothetical protein CARUB_v10022597mg [Capsella rubella] Length = 932 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = +3 Query: 6 APFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQTTQLSQHPNLQI 170 APFH++KCN+GRFIS+G+VVA WLRES TLK+LILHD +T + + + Q+ Sbjct: 866 APFHLSKCNMGRFISSGSVVATWLRESATLKLLILHDHKTTTTASTTKKSKDQQV 920