BLASTX nr result
ID: Akebia24_contig00018339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018339 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36966.3| unnamed protein product [Vitis vinifera] 95 1e-17 ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containi... 95 1e-17 ref|XP_002320970.2| hypothetical protein POPTR_0014s11380g [Popu... 87 2e-15 ref|XP_007221553.1| hypothetical protein PRUPE_ppa001263mg [Prun... 87 2e-15 ref|XP_007051141.1| S uncoupled 1 [Theobroma cacao] gi|508703402... 86 7e-15 ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Popu... 83 3e-14 ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Popu... 83 3e-14 ref|XP_002515260.1| pentatricopeptide repeat-containing protein,... 83 5e-14 ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citr... 81 1e-13 ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_006841446.1| hypothetical protein AMTR_s00003p00075520 [A... 80 3e-13 ref|XP_006355855.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_004288538.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_004240564.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 ref|XP_006417966.1| hypothetical protein EUTSA_v10006755mg [Eutr... 75 7e-12 gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus... 74 2e-11 gb|EXB28566.1| hypothetical protein L484_009725 [Morus notabilis] 74 3e-11 ref|XP_004240565.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 >emb|CBI36966.3| unnamed protein product [Vitis vinifera] Length = 730 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/55 (81%), Positives = 48/55 (87%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VAKCN+GRFISTGAVVAAWLRESGTLKVL+LHD RTNP A+ SQ NLQ Sbjct: 672 GAPFRVAKCNLGRFISTGAVVAAWLRESGTLKVLVLHDDRTNPDRARCSQISNLQ 726 >ref|XP_002271180.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic [Vitis vinifera] Length = 867 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/55 (81%), Positives = 48/55 (87%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VAKCN+GRFISTGAVVAAWLRESGTLKVL+LHD RTNP A+ SQ NLQ Sbjct: 809 GAPFRVAKCNLGRFISTGAVVAAWLRESGTLKVLVLHDDRTNPDRARCSQISNLQ 863 >ref|XP_002320970.2| hypothetical protein POPTR_0014s11380g [Populus trichocarpa] gi|550323986|gb|EEE99285.2| hypothetical protein POPTR_0014s11380g [Populus trichocarpa] Length = 875 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/55 (72%), Positives = 46/55 (83%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF +AKCN+GRFISTG+VVAAWLRESGTLKVL+LHD RT +N + Q NLQ Sbjct: 817 GAPFRLAKCNLGRFISTGSVVAAWLRESGTLKVLVLHDHRTEQENLRFGQASNLQ 871 >ref|XP_007221553.1| hypothetical protein PRUPE_ppa001263mg [Prunus persica] gi|462418303|gb|EMJ22752.1| hypothetical protein PRUPE_ppa001263mg [Prunus persica] Length = 868 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VAKCN+GRFISTG++ AAWLRESGTL+VL+LHD RT P++A L Q NLQ Sbjct: 810 GAPFRVAKCNLGRFISTGSMAAAWLRESGTLEVLVLHDDRTCPKSADLEQTSNLQ 864 >ref|XP_007051141.1| S uncoupled 1 [Theobroma cacao] gi|508703402|gb|EOX95298.1| S uncoupled 1 [Theobroma cacao] Length = 866 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF +AKCN+GRF+STG VV AWLRESGTLK+L+LHD RT P+N Q NLQ Sbjct: 808 GAPFRLAKCNLGRFVSTGPVVTAWLRESGTLKLLVLHDDRTQPENTGFGQISNLQ 862 >ref|XP_006386713.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] gi|550345388|gb|ERP64510.1| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] Length = 873 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQI 133 GAPF AKCN+GR ISTG+VVA+WLRESGTLKVL+LHD RT+ +N + Q NLQ+ Sbjct: 815 GAPFRSAKCNLGRLISTGSVVASWLRESGTLKVLVLHDDRTHQENLRFGQISNLQM 870 >ref|XP_002301519.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] gi|550345387|gb|EEE80792.2| hypothetical protein POPTR_0002s19470g [Populus trichocarpa] Length = 864 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/56 (67%), Positives = 46/56 (82%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQI 133 GAPF AKCN+GR ISTG+VVA+WLRESGTLKVL+LHD RT+ +N + Q NLQ+ Sbjct: 806 GAPFRSAKCNLGRLISTGSVVASWLRESGTLKVLVLHDDRTHQENLRFGQISNLQM 861 >ref|XP_002515260.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545740|gb|EEF47244.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 878 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/48 (75%), Positives = 44/48 (91%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQL 157 GAPF +AKCN+GRFISTG+VVAAWL+ESGTL+VL+LHD RT+P+N L Sbjct: 812 GAPFRLAKCNLGRFISTGSVVAAWLKESGTLEVLVLHDDRTHPENKDL 859 >ref|XP_006492356.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Citrus sinensis] Length = 877 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VA CN+GRFISTG +VA+WLRESGTLKVL+LHD RT+ +NA + N+Q Sbjct: 819 GAPFWVANCNLGRFISTGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQ 873 >ref|XP_006444533.1| hypothetical protein CICLE_v10018807mg [Citrus clementina] gi|557546795|gb|ESR57773.1| hypothetical protein CICLE_v10018807mg [Citrus clementina] Length = 877 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/55 (67%), Positives = 45/55 (81%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VA CN+GRFISTG +VA+WLRESGTLKVL+LHD RT+ +NA + N+Q Sbjct: 819 GAPFWVANCNLGRFISTGPMVASWLRESGTLKVLVLHDDRTHSENAGFDEMLNMQ 873 >ref|XP_004135985.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Cucumis sativus] Length = 868 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VAKCNIGR++STG+VVAAWL+ESGTLK+L+LHD RT+P + + LQ Sbjct: 810 GAPFRVAKCNIGRYVSTGSVVAAWLKESGTLKLLVLHDDRTHPDSENMDLISKLQ 864 >ref|XP_004166285.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Cucumis sativus] Length = 868 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/55 (65%), Positives = 44/55 (80%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VAKCNIGR++STG+VVAAWL+ESGTLK+L+LHD RT+P + LQ Sbjct: 810 GAPFRVAKCNIGRYVSTGSVVAAWLKESGTLKLLVLHDDRTHPDTENMDLISKLQ 864 >ref|XP_006841446.1| hypothetical protein AMTR_s00003p00075520 [Amborella trichopoda] gi|548843467|gb|ERN03121.1| hypothetical protein AMTR_s00003p00075520 [Amborella trichopoda] Length = 857 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQI 133 GAPF VAK N+GRFISTGAVV AWL+ES TLK+LILHD RT+P+ A+L Q NLQ+ Sbjct: 800 GAPFEVAKFNVGRFISTGAVVGAWLKESRTLKLLILHDERTDPE-ARLDQLSNLQV 854 >ref|XP_006355855.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Solanum tuberosum] Length = 848 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/55 (67%), Positives = 43/55 (78%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF VAKCNIGRFISTGAVV AWLRESGTL+VL+L D ++ + + Q NLQ Sbjct: 790 GAPFQVAKCNIGRFISTGAVVTAWLRESGTLEVLVLQDDTSHLRATRFGQISNLQ 844 >ref|XP_004288538.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 870 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/55 (63%), Positives = 43/55 (78%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF V +CNIGRFISTG+V AAWL+ESGTL+VL+LHD R P +A Q +L+ Sbjct: 812 GAPFRVHECNIGRFISTGSVAAAWLKESGTLEVLMLHDDRAEPNSANFGQISDLR 866 >ref|XP_004240564.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 841 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/55 (65%), Positives = 43/55 (78%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLSQHPNLQ 136 GAPF +AKCNIGRFISTGAVV AWLRESGTL+VL+L D ++ + + Q NLQ Sbjct: 783 GAPFQIAKCNIGRFISTGAVVTAWLRESGTLEVLVLQDDTSHLRATRFDQISNLQ 837 >ref|XP_006417966.1| hypothetical protein EUTSA_v10006755mg [Eutrema salsugineum] gi|557095737|gb|ESQ36319.1| hypothetical protein EUTSA_v10006755mg [Eutrema salsugineum] Length = 895 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQLS 154 GAPFHVAKCN+GRF+S+G+VVAAWLRESGTLKVL+L D + + LS Sbjct: 846 GAPFHVAKCNVGRFVSSGSVVAAWLRESGTLKVLVLEDHKHEEASLPLS 894 >gb|EYU46823.1| hypothetical protein MIMGU_mgv1a001306mg [Mimulus guttatus] Length = 843 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 5/60 (8%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRT-----NPQNAQLSQHPNLQ 136 GAPF +AKCNIGRFISTG+VV AWLRESG+LKVL+L D RT + + + + PN Q Sbjct: 780 GAPFKIAKCNIGRFISTGSVVTAWLRESGSLKVLVLQDDRTHTGTISSSSTRFDRIPNFQ 839 >gb|EXB28566.1| hypothetical protein L484_009725 [Morus notabilis] Length = 871 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTNPQNAQ 160 GAPF AKCN+GRF S G +VA WL+ESGTLKVL+LHD R++ QNA+ Sbjct: 814 GAPFEAAKCNLGRFTSPGPMVAGWLKESGTLKVLVLHDDRSHSQNAK 860 >ref|XP_004240565.1| PREDICTED: pentatricopeptide repeat-containing protein At2g31400, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 829 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 300 GAPFHVAKCNIGRFISTGAVVAAWLRESGTLKVLILHDSRTN 175 GAPF +AKCNIGRFISTGAVV AWLRESGTL+VL+L D ++ Sbjct: 783 GAPFQIAKCNIGRFISTGAVVTAWLRESGTLEVLVLQDDTSH 824