BLASTX nr result
ID: Akebia24_contig00018268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018268 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279046.2| PREDICTED: protein FAR1-RELATED SEQUENCE 5-l... 59 1e-06 emb|CBI22289.3| unnamed protein product [Vitis vinifera] 59 1e-06 emb|CAN68961.1| hypothetical protein VITISV_019276 [Vitis vinifera] 59 1e-06 >ref|XP_002279046.2| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Vitis vinifera] Length = 827 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 1 RIRMCTKCKCPGHDSRTCLWLKDPDPNTVMGHPNQELA---SAATSEDNIP 144 R R+C KCKCPGHDS TCLWLKD P++ + H + S D+IP Sbjct: 775 RTRLCAKCKCPGHDSHTCLWLKDSGPSSSLDHQKENFVCTDSPCGMGDDIP 825 >emb|CBI22289.3| unnamed protein product [Vitis vinifera] Length = 855 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 1 RIRMCTKCKCPGHDSRTCLWLKDPDPNTVMGHPNQELA---SAATSEDNIP 144 R R+C KCKCPGHDS TCLWLKD P++ + H + S D+IP Sbjct: 803 RTRLCAKCKCPGHDSHTCLWLKDSGPSSSLDHQKENFVCTDSPCGMGDDIP 853 >emb|CAN68961.1| hypothetical protein VITISV_019276 [Vitis vinifera] Length = 808 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 3/51 (5%) Frame = +1 Query: 1 RIRMCTKCKCPGHDSRTCLWLKDPDPNTVMGHPNQELA---SAATSEDNIP 144 R R+C KCKCPGHDS TCLWLKD P++ + H + S D+IP Sbjct: 756 RTRLCAKCKCPGHDSHTCLWLKDSGPSSSLDHQKENFVCTDSPCGMGDDIP 806