BLASTX nr result
ID: Akebia24_contig00018230
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia24_contig00018230 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164886.1| PREDICTED: equilibrative nucleotide transpor... 56 6e-06 ref|XP_004147175.1| PREDICTED: equilibrative nucleotide transpor... 56 6e-06 emb|CBI32138.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002263287.1| PREDICTED: equilibrative nucleoside transpor... 55 8e-06 >ref|XP_004164886.1| PREDICTED: equilibrative nucleotide transporter 1-like [Cucumis sativus] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 162 GVLVSILRIITKSIFSQDTQGLRSSANLYFIVSGVVM 272 GVLVS+LRIITKSI+ QD GLR SA LYF+VS VVM Sbjct: 176 GVLVSVLRIITKSIYPQDASGLRESARLYFVVSIVVM 212 >ref|XP_004147175.1| PREDICTED: equilibrative nucleotide transporter 1-like [Cucumis sativus] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 162 GVLVSILRIITKSIFSQDTQGLRSSANLYFIVSGVVM 272 GVLVS+LRIITKSI+ QD GLR SA LYF+VS VVM Sbjct: 176 GVLVSVLRIITKSIYPQDASGLRESARLYFVVSIVVM 212 >emb|CBI32138.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/54 (59%), Positives = 36/54 (66%) Frame = +3 Query: 111 EKPLKSSRASHMTQIIQGVLVSILRIITKSIFSQDTQGLRSSANLYFIVSGVVM 272 E P + +A GVLVS LRI TK++FSQDTQGLR SA LYF VS VVM Sbjct: 83 EMPERYMQAVVAGTAASGVLVSFLRIFTKAVFSQDTQGLRRSAILYFSVSIVVM 136 >ref|XP_002263287.1| PREDICTED: equilibrative nucleoside transporter 4-like [Vitis vinifera] Length = 417 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/54 (59%), Positives = 36/54 (66%) Frame = +3 Query: 111 EKPLKSSRASHMTQIIQGVLVSILRIITKSIFSQDTQGLRSSANLYFIVSGVVM 272 E P + +A GVLVS LRI TK++FSQDTQGLR SA LYF VS VVM Sbjct: 158 EMPERYMQAVVAGTAASGVLVSFLRIFTKAVFSQDTQGLRRSAILYFSVSIVVM 211